Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165M1B0

Protein Details
Accession A0A165M1B0    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
12-34AEGTRSIRSKKTKRQPVARDVQDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 9, mito 8, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MWTRRTDLQQGAEGTRSIRSKKTKRQPVARDVQDDSTGIKMDSIDSFQCLVQIYSHELTQC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.25
4 0.22
5 0.27
6 0.35
7 0.43
8 0.53
9 0.63
10 0.69
11 0.75
12 0.82
13 0.83
14 0.82
15 0.82
16 0.75
17 0.68
18 0.59
19 0.52
20 0.42
21 0.34
22 0.26
23 0.18
24 0.14
25 0.1
26 0.09
27 0.07
28 0.08
29 0.08
30 0.1
31 0.09
32 0.1
33 0.11
34 0.11
35 0.12
36 0.12
37 0.12
38 0.11
39 0.12
40 0.16
41 0.17