Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165IBQ1

Protein Details
Accession A0A165IBQ1    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
88-117AGCTRWADQRCKKCRTCCRMDRRGRCKVSSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 8.5, cyto 8, nucl 7, plas 4, mito 3, pero 3
Family & Domain DBs
Amino Acid Sequences MEPTYLDYDSAKAAAKCPHELCGQTHKLIVATIDDGPYHRTLVIKCPMFDFVVGQYEPDSGKVRCVVDLPNAQPRAQRPHVRCTARLAGCTRWADQRCKKCRTCCRMDRRGRCKVSSHKIDVRPPPPVAPDRLPAPVMRAPQPALPIQNEQPLPRRRIEVEIAFAMGDEGDKQYTAQASIEGDTFQIIGLSDAERKQLRIDKVAPGSLKMLDFETGDKRSIELDSKINLHPAIQTVVLFAIPVLLPWPPVYLSEYVDHIEQYATLLSSGVRKRRAFKDAFPFFVGPDHSFDVSNLVWEFLPHHVKTQYTTALQARRVRWEEVAEEAERRGWRPPPRPRYPELIIVID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.34
4 0.34
5 0.37
6 0.37
7 0.39
8 0.4
9 0.44
10 0.45
11 0.39
12 0.4
13 0.36
14 0.32
15 0.3
16 0.26
17 0.17
18 0.15
19 0.15
20 0.14
21 0.14
22 0.14
23 0.16
24 0.17
25 0.16
26 0.14
27 0.16
28 0.17
29 0.25
30 0.33
31 0.33
32 0.33
33 0.34
34 0.35
35 0.32
36 0.31
37 0.25
38 0.18
39 0.2
40 0.19
41 0.17
42 0.16
43 0.16
44 0.16
45 0.17
46 0.19
47 0.14
48 0.17
49 0.21
50 0.21
51 0.2
52 0.22
53 0.22
54 0.25
55 0.31
56 0.32
57 0.36
58 0.37
59 0.37
60 0.39
61 0.41
62 0.43
63 0.45
64 0.5
65 0.46
66 0.54
67 0.62
68 0.63
69 0.6
70 0.59
71 0.6
72 0.53
73 0.53
74 0.47
75 0.4
76 0.42
77 0.43
78 0.37
79 0.36
80 0.39
81 0.44
82 0.5
83 0.58
84 0.6
85 0.67
86 0.73
87 0.74
88 0.8
89 0.8
90 0.81
91 0.81
92 0.83
93 0.84
94 0.88
95 0.89
96 0.87
97 0.88
98 0.82
99 0.75
100 0.73
101 0.72
102 0.71
103 0.68
104 0.67
105 0.65
106 0.65
107 0.7
108 0.7
109 0.63
110 0.58
111 0.51
112 0.45
113 0.41
114 0.38
115 0.36
116 0.3
117 0.29
118 0.26
119 0.27
120 0.26
121 0.22
122 0.23
123 0.22
124 0.21
125 0.22
126 0.22
127 0.21
128 0.22
129 0.24
130 0.21
131 0.2
132 0.19
133 0.19
134 0.19
135 0.23
136 0.22
137 0.22
138 0.29
139 0.32
140 0.34
141 0.32
142 0.33
143 0.29
144 0.32
145 0.34
146 0.27
147 0.24
148 0.21
149 0.2
150 0.17
151 0.16
152 0.11
153 0.07
154 0.06
155 0.03
156 0.04
157 0.03
158 0.04
159 0.04
160 0.05
161 0.05
162 0.05
163 0.05
164 0.05
165 0.06
166 0.07
167 0.07
168 0.06
169 0.06
170 0.06
171 0.05
172 0.05
173 0.04
174 0.04
175 0.04
176 0.04
177 0.05
178 0.06
179 0.07
180 0.1
181 0.11
182 0.11
183 0.14
184 0.2
185 0.21
186 0.24
187 0.26
188 0.29
189 0.3
190 0.33
191 0.3
192 0.25
193 0.24
194 0.21
195 0.18
196 0.13
197 0.12
198 0.1
199 0.1
200 0.11
201 0.14
202 0.14
203 0.15
204 0.14
205 0.14
206 0.14
207 0.15
208 0.16
209 0.15
210 0.16
211 0.17
212 0.2
213 0.2
214 0.21
215 0.19
216 0.17
217 0.15
218 0.14
219 0.13
220 0.11
221 0.1
222 0.09
223 0.09
224 0.08
225 0.07
226 0.05
227 0.05
228 0.04
229 0.04
230 0.05
231 0.05
232 0.05
233 0.06
234 0.07
235 0.06
236 0.07
237 0.1
238 0.11
239 0.13
240 0.14
241 0.15
242 0.15
243 0.15
244 0.14
245 0.12
246 0.1
247 0.08
248 0.08
249 0.07
250 0.06
251 0.06
252 0.06
253 0.06
254 0.13
255 0.18
256 0.24
257 0.31
258 0.34
259 0.41
260 0.47
261 0.56
262 0.53
263 0.56
264 0.61
265 0.59
266 0.6
267 0.57
268 0.51
269 0.42
270 0.41
271 0.36
272 0.26
273 0.24
274 0.24
275 0.21
276 0.21
277 0.2
278 0.21
279 0.18
280 0.19
281 0.15
282 0.13
283 0.12
284 0.12
285 0.14
286 0.16
287 0.23
288 0.21
289 0.25
290 0.26
291 0.27
292 0.3
293 0.34
294 0.33
295 0.28
296 0.33
297 0.35
298 0.39
299 0.45
300 0.49
301 0.46
302 0.5
303 0.53
304 0.5
305 0.46
306 0.44
307 0.39
308 0.37
309 0.39
310 0.31
311 0.29
312 0.27
313 0.29
314 0.27
315 0.26
316 0.27
317 0.3
318 0.39
319 0.48
320 0.58
321 0.64
322 0.73
323 0.78
324 0.78
325 0.78
326 0.73
327 0.72