Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166MVD0

Protein Details
Accession A0A166MVD0    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-24SEAEKKARKKAKKDAAKEKKDGTKBasic
NLS Segment(s)
PositionSequence
5-22KKARKKAKKDAAKEKKDG
Subcellular Location(s) nucl 20, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences SEAEKKARKKAKKDAAKEKKDGTKAGGEEETQQQPSKYDDPEGAKLLASATPLDEAAKMRWVDEGVRRCRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.89
3 0.88
4 0.84
5 0.8
6 0.77
7 0.7
8 0.62
9 0.53
10 0.48
11 0.4
12 0.38
13 0.32
14 0.24
15 0.23
16 0.25
17 0.24
18 0.19
19 0.19
20 0.16
21 0.16
22 0.19
23 0.19
24 0.15
25 0.14
26 0.17
27 0.2
28 0.23
29 0.23
30 0.2
31 0.18
32 0.17
33 0.16
34 0.13
35 0.1
36 0.08
37 0.07
38 0.07
39 0.07
40 0.08
41 0.08
42 0.1
43 0.1
44 0.16
45 0.15
46 0.15
47 0.17
48 0.17
49 0.21
50 0.27
51 0.35