Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178AJ54

Protein Details
Accession A0A178AJ54   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MNLLRSCFGKKKKSALEKKKPVTSKSHydrophilic
NLS Segment(s)
PositionSequence
10-21KKKKSALEKKKP
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 8
Family & Domain DBs
Amino Acid Sequences MNLLRSCFGKKKKSALEKKKPVTSKSGGLGGGGSTQPTQPTPYVDPYVTSGAYTTNVTAGDSGNGCDPSPSNGGHHAGHHHQSSSHTGGHHHSGGSSGGHHHHSGGGHSSSYNYSGGDSGGYSGGGDSGGGGGGGGGGDGGGGGSSC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.84
3 0.86
4 0.88
5 0.9
6 0.89
7 0.85
8 0.77
9 0.74
10 0.67
11 0.61
12 0.54
13 0.49
14 0.4
15 0.34
16 0.31
17 0.23
18 0.2
19 0.14
20 0.12
21 0.08
22 0.09
23 0.1
24 0.1
25 0.13
26 0.12
27 0.16
28 0.18
29 0.21
30 0.24
31 0.23
32 0.23
33 0.23
34 0.24
35 0.2
36 0.16
37 0.12
38 0.1
39 0.11
40 0.11
41 0.08
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.07
48 0.07
49 0.07
50 0.07
51 0.08
52 0.07
53 0.07
54 0.07
55 0.09
56 0.11
57 0.11
58 0.1
59 0.12
60 0.15
61 0.15
62 0.15
63 0.15
64 0.16
65 0.19
66 0.18
67 0.16
68 0.15
69 0.16
70 0.2
71 0.2
72 0.19
73 0.16
74 0.17
75 0.19
76 0.21
77 0.2
78 0.16
79 0.13
80 0.12
81 0.13
82 0.12
83 0.1
84 0.09
85 0.1
86 0.12
87 0.13
88 0.12
89 0.13
90 0.13
91 0.14
92 0.16
93 0.15
94 0.13
95 0.13
96 0.15
97 0.14
98 0.15
99 0.14
100 0.1
101 0.1
102 0.1
103 0.1
104 0.09
105 0.08
106 0.07
107 0.07
108 0.07
109 0.06
110 0.06
111 0.06
112 0.05
113 0.05
114 0.04
115 0.04
116 0.04
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.02
124 0.02
125 0.02
126 0.02
127 0.02