Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178B1P6

Protein Details
Accession A0A178B1P6   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MTLLDEPEPKRRKRKAQTLRDSDWEPHydrophilic
NLS Segment(s)
PositionSequence
10-15KRRKRK
Subcellular Location(s) nucl 22, mito 2, cyto 1, pero 1, vacu 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR025676  Clr5_dom  
Pfam View protein in Pfam  
PF14420  Clr5  
Amino Acid Sequences MTLLDEPEPKRRKRKAQTLRDSDWEPHKENILNLYTSDMTLEDLRHIMQDKFKFSAEIRQYKSQIKKWGLGKNVTSTEMKAIVRKRQDRRILEPDRPELMFQVRRTKVGAEKIDRWMDRHSVCQGELYAPSSAGCE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.88
4 0.92
5 0.9
6 0.86
7 0.81
8 0.74
9 0.67
10 0.65
11 0.59
12 0.52
13 0.44
14 0.43
15 0.38
16 0.36
17 0.36
18 0.3
19 0.25
20 0.21
21 0.22
22 0.19
23 0.17
24 0.16
25 0.11
26 0.1
27 0.1
28 0.1
29 0.08
30 0.08
31 0.09
32 0.1
33 0.12
34 0.11
35 0.16
36 0.19
37 0.21
38 0.22
39 0.22
40 0.23
41 0.21
42 0.29
43 0.3
44 0.35
45 0.37
46 0.4
47 0.42
48 0.47
49 0.53
50 0.49
51 0.51
52 0.46
53 0.47
54 0.48
55 0.51
56 0.48
57 0.45
58 0.41
59 0.37
60 0.36
61 0.32
62 0.26
63 0.21
64 0.19
65 0.19
66 0.18
67 0.18
68 0.2
69 0.24
70 0.32
71 0.4
72 0.46
73 0.52
74 0.61
75 0.62
76 0.67
77 0.71
78 0.69
79 0.67
80 0.65
81 0.6
82 0.53
83 0.48
84 0.4
85 0.32
86 0.33
87 0.32
88 0.3
89 0.36
90 0.34
91 0.35
92 0.36
93 0.37
94 0.36
95 0.39
96 0.45
97 0.41
98 0.44
99 0.49
100 0.56
101 0.53
102 0.5
103 0.45
104 0.44
105 0.39
106 0.4
107 0.38
108 0.33
109 0.33
110 0.33
111 0.3
112 0.25
113 0.25
114 0.23
115 0.19
116 0.16