Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178AKQ2

Protein Details
Accession A0A178AKQ2    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
23-48KVEPQEKKKTPKGRAKKRLTYTRRFVBasic
NLS Segment(s)
PositionSequence
27-40QEKKKTPKGRAKKR
Subcellular Location(s) nucl 12.5, cyto_nucl 9.5, mito 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTRTYSKVEPQEKKKTPKGRAKKRLTYTRRFVNVTMTGGKRKMNPNPTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.47
4 0.49
5 0.53
6 0.58
7 0.57
8 0.57
9 0.56
10 0.59
11 0.61
12 0.62
13 0.64
14 0.69
15 0.71
16 0.71
17 0.73
18 0.73
19 0.74
20 0.76
21 0.79
22 0.79
23 0.83
24 0.85
25 0.86
26 0.86
27 0.87
28 0.85
29 0.83
30 0.8
31 0.78
32 0.74
33 0.67
34 0.58
35 0.54
36 0.49
37 0.43
38 0.42
39 0.36
40 0.35
41 0.35
42 0.38
43 0.37
44 0.42
45 0.48