Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J4KMI4

Protein Details
Accession J4KMI4    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
148-171AASTPKPPPKKRGRPSRADRAKREBasic
220-246GQSPEPAPSTKKRRRNSTPERLPPVGDHydrophilic
NLS Segment(s)
PositionSequence
149-173ASTPKPPPKKRGRPSRADRAKRELR
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MDNPFTNKEHRFVLAEMIKNSSVDVYQLEGFVKAHGIVPDWLNMQLPRGRNMNECMLATKQLSAPYHSRERNSSGSSHGDYPSISQAMRSPPTLQPTIHPPQPPSYQGSSSILPRPLPNGILPKSATTTTLVTMPDSKSPRVKSAQGAASTPKPPPKKRGRPSRADRAKRELRPLLPQHLMPRPPVDHHQQQYIYQPGMYYPPQTLPPAVAMQDSRPVHGQSPEPAPSTKKRRRNSTPERLPPVGDIMGTPKSRDGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.37
4 0.37
5 0.35
6 0.32
7 0.31
8 0.23
9 0.16
10 0.13
11 0.12
12 0.11
13 0.11
14 0.12
15 0.12
16 0.12
17 0.12
18 0.12
19 0.12
20 0.09
21 0.11
22 0.11
23 0.13
24 0.14
25 0.14
26 0.16
27 0.16
28 0.16
29 0.16
30 0.16
31 0.17
32 0.2
33 0.21
34 0.22
35 0.25
36 0.27
37 0.29
38 0.32
39 0.34
40 0.32
41 0.31
42 0.3
43 0.27
44 0.27
45 0.24
46 0.21
47 0.18
48 0.2
49 0.21
50 0.22
51 0.24
52 0.28
53 0.37
54 0.38
55 0.39
56 0.38
57 0.42
58 0.44
59 0.42
60 0.37
61 0.32
62 0.33
63 0.33
64 0.32
65 0.27
66 0.22
67 0.2
68 0.2
69 0.19
70 0.15
71 0.13
72 0.11
73 0.13
74 0.18
75 0.19
76 0.19
77 0.2
78 0.21
79 0.26
80 0.28
81 0.25
82 0.22
83 0.28
84 0.31
85 0.32
86 0.32
87 0.29
88 0.32
89 0.34
90 0.35
91 0.32
92 0.3
93 0.26
94 0.26
95 0.27
96 0.24
97 0.23
98 0.25
99 0.22
100 0.19
101 0.19
102 0.18
103 0.17
104 0.16
105 0.16
106 0.18
107 0.18
108 0.2
109 0.2
110 0.19
111 0.2
112 0.19
113 0.17
114 0.13
115 0.12
116 0.1
117 0.12
118 0.11
119 0.1
120 0.12
121 0.12
122 0.16
123 0.18
124 0.19
125 0.22
126 0.24
127 0.27
128 0.29
129 0.3
130 0.27
131 0.32
132 0.34
133 0.3
134 0.3
135 0.28
136 0.28
137 0.27
138 0.27
139 0.28
140 0.31
141 0.34
142 0.43
143 0.51
144 0.59
145 0.67
146 0.76
147 0.78
148 0.81
149 0.85
150 0.87
151 0.86
152 0.84
153 0.8
154 0.78
155 0.79
156 0.72
157 0.72
158 0.67
159 0.59
160 0.59
161 0.58
162 0.54
163 0.47
164 0.45
165 0.43
166 0.43
167 0.42
168 0.34
169 0.35
170 0.3
171 0.31
172 0.34
173 0.36
174 0.38
175 0.39
176 0.44
177 0.41
178 0.41
179 0.43
180 0.43
181 0.36
182 0.27
183 0.25
184 0.19
185 0.21
186 0.21
187 0.16
188 0.14
189 0.16
190 0.18
191 0.2
192 0.19
193 0.16
194 0.18
195 0.18
196 0.17
197 0.17
198 0.15
199 0.15
200 0.23
201 0.22
202 0.22
203 0.23
204 0.24
205 0.25
206 0.27
207 0.29
208 0.25
209 0.31
210 0.32
211 0.32
212 0.33
213 0.35
214 0.42
215 0.5
216 0.55
217 0.59
218 0.65
219 0.73
220 0.81
221 0.87
222 0.89
223 0.89
224 0.9
225 0.91
226 0.9
227 0.81
228 0.72
229 0.63
230 0.56
231 0.46
232 0.35
233 0.25
234 0.21
235 0.26
236 0.25
237 0.25