FuNGI

A0A178BCK0

Protein Details

Accession

A0A178BCK0

Localization Confidence

Medium

Confidence Score

10.4

NoLS Segment(s)

Position	Sequence	Protein Nature
58-79	VKTLNTGKSRKQREDTGKRPAP	Hydrophilic

NLS Segment(s)

Position	Sequence
45-88	AKKKGMAAAPKKGVKTLNTGKSRKQREDTGKRPAPGERKALRKR

Subcellular Location(s)

mito 15, nucl 6, cyto 4

Family & Domain DBs

InterPro	View protein in InterPro IPR019368 Ribosomal_S23/S29_mit
Gene Ontology	GO:0005739 C:mitochondrion GO:1990904 C:ribonucleoprotein complex GO:0005840 C:ribosome
Pfam	View protein in Pfam PF10236 DAP3

Amino Acid Sequences

MPPSICLRSFAQLSIDAAAHSSTAPRLLQHRAAFSTSAARYAAVAKKKGMAAAPKKGVKTLNTGKSRKQREDTGKRPAPGERKALRKRIVLSNNNALEVSSLKDLSKDNVLSEKNEGQVMGLPADTVDALRAMDAFKPTQGWSLFRRPAVLMRKEAVQLAKLFKEAEDSKKTFRRILSGERMSGKTTLVLQALSMGHLREWFVINLPEAQEIVNAHSEYAPLAGSEPTQYTQDAYMANLLQQIQIANSAFLANTKLTTKPNLPLPLAANATLKELVALGHANPETSWPVFNALWNELSQPGRPPVLLAVDGLSHIMRNSAYLSADVKPIHAFDLTLVRHFIDHLSGQKQLPNGGVVIGATSQSNAPTSPALDFSIEVAEARQKTAENVPQWNPYKSVDARVMEVLKGLETASKDLDVLKVGGLTKDEARSIMEYYAESGLLRHQVNEGFVTEKWSLAGMGNIGELERTSVRLRI

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.25
2	0.22
3	0.17
4	0.16
5	0.14
6	0.12
7	0.1
8	0.1
9	0.09
10	0.12
11	0.12
12	0.15
13	0.19
14	0.25
15	0.32
16	0.35
17	0.39
18	0.38
19	0.4
20	0.38
21	0.35
22	0.37
23	0.3
24	0.28
25	0.23
26	0.21
27	0.19
28	0.25
29	0.3
30	0.3
31	0.32
32	0.31
33	0.35
34	0.36
35	0.38
36	0.37
37	0.4
38	0.41
39	0.48
40	0.55
41	0.55
42	0.55
43	0.56
44	0.55
45	0.48
46	0.5
47	0.5
48	0.51
49	0.56
50	0.59
51	0.64
52	0.7
53	0.77
54	0.75
55	0.72
56	0.72
57	0.74
58	0.8
59	0.79
60	0.81
61	0.78
62	0.71
63	0.68
64	0.66
65	0.62
66	0.58
67	0.6
68	0.56
69	0.6
70	0.66
71	0.73
72	0.71
73	0.68
74	0.67
75	0.67
76	0.71
77	0.68
78	0.66
79	0.66
80	0.61
81	0.56
82	0.51
83	0.4
84	0.31
85	0.24
86	0.2
87	0.12
88	0.12
89	0.11
90	0.13
91	0.14
92	0.15
93	0.2
94	0.19
95	0.18
96	0.24
97	0.26
98	0.25
99	0.29
100	0.3
101	0.25
102	0.25
103	0.23
104	0.17
105	0.19
106	0.18
107	0.14
108	0.11
109	0.1
110	0.09
111	0.09
112	0.09
113	0.05
114	0.04
115	0.04
116	0.04
117	0.04
118	0.05
119	0.05
120	0.07
121	0.1
122	0.1
123	0.1
124	0.12
125	0.12
126	0.17
127	0.18
128	0.19
129	0.23
130	0.32
131	0.35
132	0.34
133	0.35
134	0.31
135	0.37
136	0.43
137	0.41
138	0.36
139	0.33
140	0.35
141	0.34
142	0.35
143	0.29
144	0.22
145	0.21
146	0.21
147	0.2
148	0.19
149	0.18
150	0.15
151	0.21
152	0.21
153	0.25
154	0.29
155	0.31
156	0.36
157	0.42
158	0.44
159	0.42
160	0.4
161	0.39
162	0.36
163	0.42
164	0.45
165	0.42
166	0.44
167	0.43
168	0.43
169	0.39
170	0.35
171	0.27
172	0.18
173	0.16
174	0.15
175	0.12
176	0.11
177	0.09
178	0.11
179	0.11
180	0.11
181	0.1
182	0.08
183	0.08
184	0.08
185	0.09
186	0.07
187	0.09
188	0.08
189	0.09
190	0.09
191	0.1
192	0.11
193	0.11
194	0.1
195	0.09
196	0.09
197	0.08
198	0.07
199	0.08
200	0.09
201	0.09
202	0.09
203	0.09
204	0.09
205	0.08
206	0.08
207	0.06
208	0.04
209	0.05
210	0.05
211	0.05
212	0.06
213	0.06
214	0.07
215	0.08
216	0.08
217	0.08
218	0.08
219	0.09
220	0.08
221	0.08
222	0.08
223	0.07
224	0.08
225	0.08
226	0.08
227	0.07
228	0.07
229	0.07
230	0.05
231	0.07
232	0.07
233	0.06
234	0.05
235	0.06
236	0.05
237	0.05
238	0.07
239	0.05
240	0.06
241	0.07
242	0.1
243	0.11
244	0.14
245	0.15
246	0.17
247	0.23
248	0.25
249	0.24
250	0.24
251	0.25
252	0.26
253	0.24
254	0.22
255	0.18
256	0.15
257	0.16
258	0.14
259	0.12
260	0.08
261	0.07
262	0.06
263	0.06
264	0.06
265	0.05
266	0.08
267	0.08
268	0.08
269	0.08
270	0.09
271	0.1
272	0.11
273	0.11
274	0.08
275	0.12
276	0.12
277	0.13
278	0.14
279	0.14
280	0.14
281	0.14
282	0.15
283	0.14
284	0.15
285	0.14
286	0.14
287	0.15
288	0.14
289	0.14
290	0.14
291	0.12
292	0.13
293	0.12
294	0.1
295	0.09
296	0.08
297	0.08
298	0.09
299	0.07
300	0.05
301	0.05
302	0.06
303	0.05
304	0.06
305	0.07
306	0.07
307	0.08
308	0.09
309	0.11
310	0.11
311	0.15
312	0.14
313	0.14
314	0.13
315	0.13
316	0.14
317	0.12
318	0.1
319	0.08
320	0.16
321	0.16
322	0.16
323	0.17
324	0.15
325	0.15
326	0.16
327	0.15
328	0.1
329	0.11
330	0.14
331	0.16
332	0.19
333	0.2
334	0.22
335	0.22
336	0.21
337	0.2
338	0.16
339	0.14
340	0.11
341	0.11
342	0.08
343	0.08
344	0.07
345	0.06
346	0.05
347	0.06
348	0.06
349	0.06
350	0.07
351	0.07
352	0.08
353	0.09
354	0.1
355	0.1
356	0.11
357	0.12
358	0.12
359	0.12
360	0.11
361	0.12
362	0.11
363	0.1
364	0.09
365	0.13
366	0.13
367	0.13
368	0.14
369	0.13
370	0.16
371	0.23
372	0.29
373	0.28
374	0.34
375	0.37
376	0.45
377	0.48
378	0.48
379	0.43
380	0.39
381	0.42
382	0.37
383	0.39
384	0.37
385	0.34
386	0.35
387	0.37
388	0.36
389	0.28
390	0.28
391	0.22
392	0.16
393	0.15
394	0.12
395	0.11
396	0.11
397	0.13
398	0.13
399	0.13
400	0.13
401	0.13
402	0.14
403	0.13
404	0.13
405	0.11
406	0.12
407	0.13
408	0.13
409	0.14
410	0.15
411	0.17
412	0.18
413	0.19
414	0.17
415	0.18
416	0.19
417	0.2
418	0.18
419	0.16
420	0.14
421	0.16
422	0.16
423	0.14
424	0.12
425	0.11
426	0.13
427	0.18
428	0.18
429	0.16
430	0.18
431	0.2
432	0.22
433	0.23
434	0.21
435	0.18
436	0.18
437	0.23
438	0.2
439	0.19
440	0.17
441	0.16
442	0.15
443	0.13
444	0.15
445	0.1
446	0.1
447	0.1
448	0.1
449	0.09
450	0.09
451	0.08
452	0.1
453	0.1
454	0.13

A0A178BCK0

3D AlphaFold-predicted Structure Viewer