Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0W6F9

Protein Details
Accession G0W6F9   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
91-110SSIHQVKKVHRDIRKRNERIBasic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
IPR020904  Sc_DH/Rdtase_CS  
IPR002347  SDR_fam  
Gene Ontology GO:0016491  F:oxidoreductase activity  
KEGG ndi:NDAI_0B03360  -  
Pfam View protein in Pfam  
PF00106  adh_short  
PROSITE View protein in PROSITE  
PS00061  ADH_SHORT  
Amino Acid Sequences MVLLVRNVLLNILISFQKRFTFPFLEKKTPEDTILKKGSVAIITGGSGGLGLEIVKRLTSRNVTCIILDVIPPNVRFKKEEKVIFYRCDISSIHQVKKVHRDIRKRNERISLLINNAGITCVKPLIEMTNQEIKKIIEVNFIGAYGMIETFLPDLMRDNDKCYIVNIASVLGLISPANLTGYGASKAGMIAVHKSLASSLKNCKEGHKIRTLLVCTGKIKTTMFETVPTPSSILAPDIDPSELAKLIIHSIDNNLEHTLKEPYYVNLVPFFKMLDRPYIALLKRFSGMNQATSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.17
4 0.19
5 0.2
6 0.22
7 0.26
8 0.3
9 0.34
10 0.43
11 0.49
12 0.55
13 0.55
14 0.57
15 0.56
16 0.51
17 0.5
18 0.47
19 0.43
20 0.43
21 0.46
22 0.42
23 0.37
24 0.36
25 0.34
26 0.27
27 0.24
28 0.16
29 0.12
30 0.12
31 0.12
32 0.1
33 0.07
34 0.06
35 0.05
36 0.04
37 0.03
38 0.03
39 0.04
40 0.05
41 0.05
42 0.06
43 0.07
44 0.09
45 0.14
46 0.22
47 0.23
48 0.27
49 0.3
50 0.3
51 0.29
52 0.3
53 0.26
54 0.19
55 0.18
56 0.14
57 0.14
58 0.16
59 0.17
60 0.21
61 0.23
62 0.24
63 0.26
64 0.29
65 0.35
66 0.4
67 0.45
68 0.46
69 0.52
70 0.54
71 0.54
72 0.53
73 0.48
74 0.4
75 0.36
76 0.3
77 0.25
78 0.31
79 0.34
80 0.34
81 0.34
82 0.37
83 0.39
84 0.48
85 0.53
86 0.51
87 0.53
88 0.61
89 0.67
90 0.75
91 0.82
92 0.77
93 0.73
94 0.73
95 0.67
96 0.6
97 0.55
98 0.48
99 0.39
100 0.36
101 0.31
102 0.23
103 0.21
104 0.18
105 0.12
106 0.09
107 0.07
108 0.05
109 0.05
110 0.05
111 0.06
112 0.08
113 0.1
114 0.11
115 0.14
116 0.23
117 0.23
118 0.23
119 0.24
120 0.21
121 0.2
122 0.22
123 0.19
124 0.15
125 0.15
126 0.16
127 0.15
128 0.15
129 0.13
130 0.1
131 0.09
132 0.05
133 0.05
134 0.03
135 0.03
136 0.03
137 0.03
138 0.04
139 0.04
140 0.03
141 0.05
142 0.07
143 0.11
144 0.11
145 0.14
146 0.16
147 0.17
148 0.17
149 0.16
150 0.16
151 0.13
152 0.13
153 0.1
154 0.08
155 0.07
156 0.07
157 0.06
158 0.04
159 0.04
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.04
168 0.06
169 0.06
170 0.07
171 0.07
172 0.07
173 0.06
174 0.07
175 0.07
176 0.06
177 0.07
178 0.08
179 0.08
180 0.08
181 0.08
182 0.09
183 0.11
184 0.13
185 0.15
186 0.22
187 0.27
188 0.32
189 0.33
190 0.36
191 0.42
192 0.48
193 0.5
194 0.51
195 0.48
196 0.46
197 0.52
198 0.49
199 0.44
200 0.41
201 0.38
202 0.32
203 0.32
204 0.3
205 0.26
206 0.25
207 0.21
208 0.21
209 0.21
210 0.2
211 0.2
212 0.2
213 0.21
214 0.22
215 0.22
216 0.18
217 0.15
218 0.15
219 0.13
220 0.13
221 0.11
222 0.09
223 0.1
224 0.11
225 0.11
226 0.1
227 0.1
228 0.11
229 0.1
230 0.1
231 0.09
232 0.09
233 0.1
234 0.11
235 0.11
236 0.1
237 0.12
238 0.16
239 0.16
240 0.17
241 0.18
242 0.17
243 0.17
244 0.19
245 0.21
246 0.17
247 0.18
248 0.18
249 0.17
250 0.23
251 0.25
252 0.24
253 0.26
254 0.28
255 0.26
256 0.25
257 0.25
258 0.21
259 0.25
260 0.25
261 0.25
262 0.26
263 0.26
264 0.3
265 0.36
266 0.35
267 0.36
268 0.36
269 0.32
270 0.31
271 0.31
272 0.28
273 0.3
274 0.31