Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178B123

Protein Details
Accession A0A178B123    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MGKRKSASKPQGPKKKEKLPSTFQCLFHydrophilic
NLS Segment(s)
PositionSequence
3-18KRKSASKPQGPKKKEK
Subcellular Location(s) nucl 15, mito 5.5, cyto_mito 5.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018247  EF_Hand_1_Ca_BS  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
PROSITE View protein in PROSITE  
PS00018  EF_HAND_1  
Amino Acid Sequences MGKRKSASKPQGPKKKEKLPSTFQCLFCNHEKSVSVSIEKKSGVGNLQCKVCGQTFQTNINYLSAPVDVYADWIDACDAVAKEAAAGKMATARSNNRMGQMPTAQTEEADADDDGFIEQDDLDAEGEYAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.85
4 0.83
5 0.81
6 0.8
7 0.82
8 0.8
9 0.78
10 0.7
11 0.65
12 0.57
13 0.53
14 0.49
15 0.46
16 0.37
17 0.32
18 0.31
19 0.31
20 0.34
21 0.31
22 0.28
23 0.27
24 0.27
25 0.27
26 0.26
27 0.23
28 0.19
29 0.18
30 0.19
31 0.2
32 0.24
33 0.24
34 0.25
35 0.25
36 0.24
37 0.25
38 0.21
39 0.18
40 0.17
41 0.2
42 0.22
43 0.26
44 0.27
45 0.27
46 0.27
47 0.25
48 0.22
49 0.15
50 0.13
51 0.09
52 0.08
53 0.06
54 0.06
55 0.05
56 0.06
57 0.06
58 0.05
59 0.05
60 0.05
61 0.05
62 0.04
63 0.04
64 0.05
65 0.05
66 0.05
67 0.06
68 0.05
69 0.06
70 0.08
71 0.08
72 0.07
73 0.07
74 0.06
75 0.1
76 0.1
77 0.12
78 0.13
79 0.17
80 0.2
81 0.26
82 0.27
83 0.26
84 0.3
85 0.3
86 0.31
87 0.32
88 0.29
89 0.26
90 0.27
91 0.25
92 0.2
93 0.2
94 0.16
95 0.13
96 0.13
97 0.11
98 0.09
99 0.09
100 0.09
101 0.08
102 0.07
103 0.07
104 0.05
105 0.05
106 0.04
107 0.05
108 0.06
109 0.06
110 0.06