Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178AX96

Protein Details
Accession A0A178AX96   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-34STAVCRAKRRFTRIRRTWSPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MRVWLVKSRTDVARSTAVCRAKRRFTRIRRTWSPINKAQNAVLVGHTGAGYALLEETAPHASVCCCSCGPRSVQAASRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.36
3 0.37
4 0.4
5 0.42
6 0.48
7 0.5
8 0.53
9 0.59
10 0.65
11 0.69
12 0.72
13 0.78
14 0.79
15 0.82
16 0.79
17 0.78
18 0.79
19 0.77
20 0.74
21 0.7
22 0.68
23 0.61
24 0.55
25 0.48
26 0.41
27 0.33
28 0.27
29 0.19
30 0.12
31 0.1
32 0.09
33 0.08
34 0.05
35 0.04
36 0.04
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.05
44 0.06
45 0.06
46 0.06
47 0.07
48 0.07
49 0.1
50 0.12
51 0.13
52 0.13
53 0.15
54 0.19
55 0.23
56 0.26
57 0.3
58 0.34
59 0.36