Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178BCA0

Protein Details
Accession A0A178BCA0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
72-92QDMPSKTKHAREKGKQHAQRCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MRVPLSIFGCPRTARAAGPSLCDRLTCCAMGCVGGRGLIIELHVLLAWRLKLRLYLRGRAVSWLVGEYCASQDMPSKTKHAREKGKQHAQRCLSRIDDLDGSMIKGRTSWLCMSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.3
4 0.27
5 0.31
6 0.33
7 0.31
8 0.29
9 0.29
10 0.26
11 0.23
12 0.25
13 0.2
14 0.17
15 0.15
16 0.15
17 0.16
18 0.16
19 0.12
20 0.1
21 0.09
22 0.09
23 0.08
24 0.08
25 0.07
26 0.06
27 0.05
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.05
34 0.06
35 0.06
36 0.07
37 0.07
38 0.12
39 0.13
40 0.22
41 0.24
42 0.29
43 0.31
44 0.33
45 0.33
46 0.3
47 0.29
48 0.2
49 0.17
50 0.13
51 0.1
52 0.08
53 0.08
54 0.07
55 0.06
56 0.06
57 0.06
58 0.06
59 0.11
60 0.13
61 0.16
62 0.17
63 0.22
64 0.25
65 0.33
66 0.41
67 0.45
68 0.53
69 0.6
70 0.69
71 0.75
72 0.82
73 0.81
74 0.78
75 0.79
76 0.76
77 0.73
78 0.65
79 0.59
80 0.51
81 0.47
82 0.43
83 0.37
84 0.31
85 0.25
86 0.25
87 0.2
88 0.19
89 0.2
90 0.18
91 0.14
92 0.14
93 0.16
94 0.16
95 0.2