Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178B6Y6

Protein Details
Accession A0A178B6Y6    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
35-76VAAPSKVVKSKPKARRRRLDPWAPKRKPNPNPKPRAPARTHFHydrophilic
89-110QFPTWFPKSQRRRWPQSWDVPFHydrophilic
NLS Segment(s)
PositionSequence
40-72KVVKSKPKARRRRLDPWAPKRKPNPNPKPRAPA
Subcellular Location(s) mito 16.5, cyto_mito 10, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR031127  E3_UB_ligase_RBR  
IPR002867  IBR_dom  
IPR044066  TRIAD_supradom  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0004842  F:ubiquitin-protein transferase activity  
GO:0016567  P:protein ubiquitination  
Pfam View protein in Pfam  
PF01485  IBR  
PROSITE View protein in PROSITE  
PS51873  TRIAD  
CDD cd20335  BRcat_RBR  
Amino Acid Sequences MVARRPSCQPGATAPQATSAPTNTRVLRSHTAAQVAAPSKVVKSKPKARRRRLDPWAPKRKPNPNPKPRAPARTHFTCRICVEDLPKSQFPTWFPKSQRRRWPQSWDVPFDCIEHLAIRPSRRKGEPVCKTCIGRALSARLDQVGARQVGVGCVEPGCQVPWSWDYVMRYMPAGEPLEKYNMEMFEVWRSDSTIKPITCIAPDCEAIGLPDPTAPGYPQISCNTCGHRSCSLCEVPWHKDLTCAEHAAKHVDEKMTDPEKDTLKLMQTKDGKRCPNCQLVIEKDGGCDSMFCIGCQKYFNWATAASAVPGAKKAEPVVASDPYWHRPPGEPIVCEMDALQRGPNPVAAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.36
4 0.35
5 0.3
6 0.25
7 0.24
8 0.25
9 0.3
10 0.29
11 0.33
12 0.35
13 0.4
14 0.43
15 0.43
16 0.46
17 0.44
18 0.44
19 0.39
20 0.36
21 0.36
22 0.32
23 0.27
24 0.23
25 0.2
26 0.19
27 0.25
28 0.3
29 0.32
30 0.4
31 0.5
32 0.59
33 0.69
34 0.78
35 0.83
36 0.89
37 0.89
38 0.9
39 0.9
40 0.9
41 0.91
42 0.91
43 0.92
44 0.86
45 0.86
46 0.85
47 0.85
48 0.84
49 0.84
50 0.84
51 0.84
52 0.89
53 0.88
54 0.89
55 0.86
56 0.86
57 0.82
58 0.79
59 0.76
60 0.75
61 0.73
62 0.71
63 0.66
64 0.62
65 0.57
66 0.52
67 0.47
68 0.4
69 0.38
70 0.37
71 0.4
72 0.4
73 0.4
74 0.39
75 0.38
76 0.38
77 0.37
78 0.39
79 0.39
80 0.41
81 0.44
82 0.51
83 0.6
84 0.66
85 0.73
86 0.74
87 0.78
88 0.78
89 0.82
90 0.81
91 0.81
92 0.79
93 0.75
94 0.66
95 0.59
96 0.52
97 0.43
98 0.34
99 0.25
100 0.18
101 0.12
102 0.11
103 0.14
104 0.16
105 0.21
106 0.27
107 0.3
108 0.36
109 0.37
110 0.43
111 0.46
112 0.54
113 0.58
114 0.57
115 0.59
116 0.57
117 0.56
118 0.5
119 0.49
120 0.4
121 0.32
122 0.29
123 0.27
124 0.25
125 0.25
126 0.25
127 0.18
128 0.17
129 0.14
130 0.14
131 0.14
132 0.12
133 0.11
134 0.11
135 0.11
136 0.11
137 0.11
138 0.1
139 0.06
140 0.06
141 0.06
142 0.06
143 0.06
144 0.06
145 0.06
146 0.06
147 0.08
148 0.09
149 0.11
150 0.11
151 0.13
152 0.13
153 0.14
154 0.15
155 0.13
156 0.12
157 0.11
158 0.1
159 0.11
160 0.11
161 0.1
162 0.11
163 0.11
164 0.14
165 0.13
166 0.14
167 0.12
168 0.11
169 0.11
170 0.11
171 0.11
172 0.11
173 0.12
174 0.11
175 0.1
176 0.11
177 0.12
178 0.12
179 0.16
180 0.19
181 0.18
182 0.19
183 0.2
184 0.2
185 0.2
186 0.21
187 0.18
188 0.14
189 0.14
190 0.14
191 0.12
192 0.11
193 0.11
194 0.11
195 0.09
196 0.06
197 0.07
198 0.06
199 0.07
200 0.07
201 0.07
202 0.07
203 0.09
204 0.09
205 0.12
206 0.16
207 0.17
208 0.2
209 0.22
210 0.25
211 0.28
212 0.28
213 0.29
214 0.32
215 0.32
216 0.31
217 0.34
218 0.31
219 0.27
220 0.32
221 0.33
222 0.31
223 0.33
224 0.34
225 0.28
226 0.31
227 0.31
228 0.32
229 0.3
230 0.28
231 0.25
232 0.25
233 0.26
234 0.25
235 0.24
236 0.2
237 0.2
238 0.18
239 0.18
240 0.18
241 0.25
242 0.26
243 0.26
244 0.27
245 0.28
246 0.29
247 0.3
248 0.29
249 0.24
250 0.26
251 0.32
252 0.3
253 0.34
254 0.4
255 0.45
256 0.53
257 0.58
258 0.62
259 0.6
260 0.66
261 0.65
262 0.65
263 0.61
264 0.56
265 0.55
266 0.51
267 0.5
268 0.46
269 0.39
270 0.31
271 0.29
272 0.26
273 0.18
274 0.13
275 0.11
276 0.14
277 0.14
278 0.14
279 0.19
280 0.19
281 0.2
282 0.22
283 0.22
284 0.24
285 0.25
286 0.27
287 0.24
288 0.23
289 0.23
290 0.24
291 0.24
292 0.16
293 0.17
294 0.16
295 0.14
296 0.17
297 0.18
298 0.16
299 0.17
300 0.17
301 0.2
302 0.2
303 0.23
304 0.26
305 0.26
306 0.26
307 0.3
308 0.33
309 0.33
310 0.36
311 0.33
312 0.31
313 0.32
314 0.38
315 0.43
316 0.45
317 0.41
318 0.41
319 0.47
320 0.44
321 0.4
322 0.34
323 0.29
324 0.26
325 0.26
326 0.25
327 0.2
328 0.23
329 0.24
330 0.25