Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178AME9

Protein Details
Accession A0A178AME9    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
38-63GYIVQSHKTSRRKQCHRKHHMPNISHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 4, nucl 3
Family & Domain DBs
Amino Acid Sequences MSWFPLVIRYVISAHAMLCHANHRSPNRPSREEMVYPGYIVQSHKTSRRKQCHRKHHMPNISHPLRGPRIRSTTYADPTNQLLAVEGYLRCILDINAVAEQTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.12
4 0.11
5 0.11
6 0.14
7 0.15
8 0.18
9 0.24
10 0.28
11 0.36
12 0.44
13 0.52
14 0.55
15 0.56
16 0.57
17 0.56
18 0.56
19 0.49
20 0.44
21 0.4
22 0.32
23 0.29
24 0.25
25 0.21
26 0.16
27 0.15
28 0.14
29 0.12
30 0.15
31 0.23
32 0.3
33 0.39
34 0.47
35 0.57
36 0.66
37 0.74
38 0.81
39 0.85
40 0.87
41 0.89
42 0.89
43 0.89
44 0.86
45 0.78
46 0.76
47 0.75
48 0.66
49 0.57
50 0.47
51 0.43
52 0.41
53 0.42
54 0.38
55 0.34
56 0.38
57 0.4
58 0.42
59 0.43
60 0.44
61 0.45
62 0.45
63 0.39
64 0.35
65 0.34
66 0.33
67 0.26
68 0.18
69 0.15
70 0.11
71 0.11
72 0.11
73 0.09
74 0.1
75 0.11
76 0.11
77 0.1
78 0.1
79 0.1
80 0.11
81 0.14
82 0.14
83 0.14