Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J5K5X8

Protein Details
Accession J5K5X8    Localization Confidence High Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
125-146LTSDAKRRRDRAQRLSKQRSVLHydrophilic
273-298DPFGINKRRLDRQKSRDQLKKSIRSTHydrophilic
NLS Segment(s)
PositionSequence
131-133RRR
Subcellular Location(s) nucl 25
Family & Domain DBs
Amino Acid Sequences MEEGFGCSATISFQSAARIAQNRDAYKKNSGDPEQYDGGVATSFACPRRIKLFCPSTSPPPEPPQERYMVPGDDQYRIVEDELLETAQRFTTHLHRAEYTRLKLIARSKNDAAIREIKRPVIGPLTSDAKRRRDRAQRLSKQRSVLSAQDGSTTQDESANGSSPWVGTNLRGLLNAPRAESRTLAAPPMPSAVPSSRTKAAAGHHPPRPPSSPRQRPADGGSFATPVATGRARHPATPATLSGMASSSSAPSRPAKNEAETRPPEDDDLDFDDPFGINKRRLDRQKSRDQLKKSIRSTPTKVSSSDSMPSFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.16
4 0.21
5 0.26
6 0.26
7 0.33
8 0.39
9 0.41
10 0.47
11 0.51
12 0.5
13 0.52
14 0.54
15 0.52
16 0.53
17 0.53
18 0.54
19 0.52
20 0.54
21 0.47
22 0.43
23 0.37
24 0.28
25 0.24
26 0.17
27 0.13
28 0.09
29 0.09
30 0.12
31 0.13
32 0.19
33 0.19
34 0.23
35 0.32
36 0.33
37 0.35
38 0.42
39 0.49
40 0.46
41 0.53
42 0.55
43 0.55
44 0.59
45 0.6
46 0.55
47 0.52
48 0.57
49 0.54
50 0.54
51 0.49
52 0.45
53 0.42
54 0.4
55 0.38
56 0.32
57 0.28
58 0.29
59 0.26
60 0.24
61 0.25
62 0.21
63 0.19
64 0.18
65 0.18
66 0.13
67 0.11
68 0.1
69 0.1
70 0.1
71 0.09
72 0.08
73 0.08
74 0.08
75 0.08
76 0.08
77 0.1
78 0.16
79 0.23
80 0.26
81 0.28
82 0.29
83 0.31
84 0.39
85 0.43
86 0.38
87 0.35
88 0.34
89 0.32
90 0.34
91 0.41
92 0.4
93 0.38
94 0.41
95 0.39
96 0.43
97 0.45
98 0.42
99 0.37
100 0.38
101 0.36
102 0.36
103 0.37
104 0.31
105 0.3
106 0.29
107 0.27
108 0.23
109 0.2
110 0.15
111 0.17
112 0.22
113 0.22
114 0.28
115 0.32
116 0.36
117 0.41
118 0.44
119 0.5
120 0.55
121 0.64
122 0.68
123 0.74
124 0.75
125 0.8
126 0.85
127 0.8
128 0.74
129 0.65
130 0.57
131 0.48
132 0.41
133 0.34
134 0.27
135 0.23
136 0.2
137 0.19
138 0.18
139 0.15
140 0.14
141 0.1
142 0.09
143 0.09
144 0.09
145 0.1
146 0.09
147 0.08
148 0.08
149 0.08
150 0.07
151 0.07
152 0.07
153 0.07
154 0.06
155 0.08
156 0.1
157 0.1
158 0.1
159 0.1
160 0.12
161 0.16
162 0.17
163 0.16
164 0.15
165 0.17
166 0.17
167 0.17
168 0.15
169 0.13
170 0.13
171 0.13
172 0.13
173 0.11
174 0.11
175 0.12
176 0.12
177 0.09
178 0.11
179 0.11
180 0.15
181 0.17
182 0.21
183 0.21
184 0.22
185 0.22
186 0.22
187 0.24
188 0.29
189 0.35
190 0.38
191 0.4
192 0.43
193 0.44
194 0.45
195 0.48
196 0.44
197 0.46
198 0.5
199 0.56
200 0.59
201 0.64
202 0.62
203 0.61
204 0.61
205 0.57
206 0.48
207 0.4
208 0.35
209 0.28
210 0.26
211 0.22
212 0.17
213 0.1
214 0.11
215 0.11
216 0.11
217 0.13
218 0.23
219 0.24
220 0.25
221 0.27
222 0.27
223 0.29
224 0.3
225 0.28
226 0.23
227 0.23
228 0.23
229 0.2
230 0.18
231 0.14
232 0.12
233 0.12
234 0.09
235 0.09
236 0.1
237 0.13
238 0.17
239 0.22
240 0.25
241 0.31
242 0.33
243 0.39
244 0.47
245 0.49
246 0.55
247 0.54
248 0.54
249 0.52
250 0.49
251 0.43
252 0.37
253 0.32
254 0.26
255 0.28
256 0.26
257 0.22
258 0.21
259 0.21
260 0.18
261 0.19
262 0.22
263 0.2
264 0.22
265 0.28
266 0.34
267 0.44
268 0.53
269 0.63
270 0.67
271 0.72
272 0.79
273 0.83
274 0.87
275 0.86
276 0.83
277 0.83
278 0.83
279 0.83
280 0.77
281 0.77
282 0.75
283 0.75
284 0.75
285 0.74
286 0.72
287 0.65
288 0.62
289 0.58
290 0.54
291 0.49
292 0.49