Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178ALU6

Protein Details
Accession A0A178ALU6    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MRRPCRPCALPRPRPPRKACKYDCHHGSRPBasic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto 7, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
IPR002347  SDR_fam  
Pfam View protein in Pfam  
PF00106  adh_short  
Amino Acid Sequences MRRPCRPCALPRPRPPRKACKYDCHHGSRPYEPYKDAYDTPDGVGDGRPTALQVLIDNCFVGTYAGKVVLTTGGTNGIGLETARALRANEADVYFTAHSAEKAEKVRRVIFAKSQGKGKLEVVRMDMNSLESVRSAAKSFCRGAASSTSSLIMPASSTHKLKSRVVCVSVTTGGVSKGDKSVLTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.9
3 0.89
4 0.88
5 0.89
6 0.86
7 0.85
8 0.83
9 0.83
10 0.83
11 0.81
12 0.78
13 0.74
14 0.71
15 0.67
16 0.67
17 0.64
18 0.58
19 0.51
20 0.47
21 0.45
22 0.43
23 0.38
24 0.34
25 0.31
26 0.29
27 0.27
28 0.25
29 0.2
30 0.17
31 0.17
32 0.13
33 0.1
34 0.09
35 0.08
36 0.07
37 0.08
38 0.07
39 0.07
40 0.07
41 0.09
42 0.1
43 0.1
44 0.1
45 0.09
46 0.08
47 0.08
48 0.08
49 0.05
50 0.05
51 0.05
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.07
58 0.06
59 0.06
60 0.06
61 0.06
62 0.06
63 0.06
64 0.05
65 0.04
66 0.04
67 0.04
68 0.03
69 0.04
70 0.04
71 0.05
72 0.05
73 0.06
74 0.06
75 0.07
76 0.08
77 0.08
78 0.08
79 0.08
80 0.1
81 0.09
82 0.08
83 0.08
84 0.08
85 0.08
86 0.08
87 0.09
88 0.1
89 0.16
90 0.19
91 0.21
92 0.24
93 0.26
94 0.3
95 0.32
96 0.3
97 0.3
98 0.37
99 0.4
100 0.39
101 0.41
102 0.4
103 0.38
104 0.38
105 0.37
106 0.33
107 0.3
108 0.3
109 0.28
110 0.28
111 0.27
112 0.25
113 0.22
114 0.17
115 0.15
116 0.13
117 0.1
118 0.07
119 0.08
120 0.08
121 0.09
122 0.09
123 0.11
124 0.14
125 0.18
126 0.19
127 0.21
128 0.23
129 0.22
130 0.23
131 0.26
132 0.28
133 0.25
134 0.24
135 0.22
136 0.2
137 0.2
138 0.17
139 0.12
140 0.07
141 0.08
142 0.13
143 0.17
144 0.18
145 0.21
146 0.28
147 0.33
148 0.39
149 0.45
150 0.47
151 0.49
152 0.5
153 0.48
154 0.43
155 0.43
156 0.38
157 0.31
158 0.24
159 0.19
160 0.17
161 0.17
162 0.16
163 0.13
164 0.13
165 0.14