Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178AXM9

Protein Details
Accession A0A178AXM9    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-34PSEIGPYDGRKARRKRCDACVKRKVRVKCHGGVBasic
NLS Segment(s)
Subcellular Location(s) nucl 9, cyto 8, mito 5, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR021858  Fun_TF  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF11951  Fungal_trans_2  
CDD cd00067  GAL4  
Amino Acid Sequences MPSEIGPYDGRKARRKRCDACVKRKVRVKCHGGVPCATCKRTGRECTIAVKQASLLPVFVSQDSSLQTNCRRDTKQILAYDLIRMPQSVDVAWKDRAVPYFFKVFMPMNIFSSSQSMDKEISAIASTSRGLRDAIEAVATLHYKRHSMLTSSTPADRCDADQALQAYGRSVRHVQSRITSEAFLGAPCALWTTFVLGLFELMQDSTGTNWLSHFLNGTCVILRLQHPRTLACPGEDNERKRRFFLATRIFEIARSLIYSEPTFLSDPEWTDAIASLRKADCESECHPKEVLFDLLPSVADLSIRTMNICDSLAKGWVESQSQVIESLAREGLDLQRSLQQWCVAAEWWEQASQFKASNDPSARKLDVELLIGYVYYHAISIYLSGTFDYHVYWALPGAPCAPILPRHQIDHHVSEILRIGQELLTLGVSGLLLFFPLRVAGARAVDVWSRNLIMDLLQTTAGRGFSVADAISIDLSELWIDQSVVSGLSPVDADPFTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.8
3 0.8
4 0.85
5 0.89
6 0.9
7 0.9
8 0.91
9 0.88
10 0.87
11 0.87
12 0.86
13 0.85
14 0.84
15 0.81
16 0.78
17 0.79
18 0.77
19 0.73
20 0.69
21 0.63
22 0.63
23 0.62
24 0.55
25 0.52
26 0.49
27 0.53
28 0.57
29 0.6
30 0.57
31 0.57
32 0.6
33 0.61
34 0.63
35 0.61
36 0.52
37 0.45
38 0.39
39 0.35
40 0.33
41 0.27
42 0.2
43 0.14
44 0.16
45 0.16
46 0.15
47 0.15
48 0.13
49 0.14
50 0.16
51 0.17
52 0.16
53 0.2
54 0.26
55 0.31
56 0.35
57 0.41
58 0.42
59 0.46
60 0.53
61 0.56
62 0.57
63 0.53
64 0.52
65 0.48
66 0.47
67 0.45
68 0.38
69 0.31
70 0.23
71 0.2
72 0.18
73 0.16
74 0.16
75 0.12
76 0.15
77 0.17
78 0.2
79 0.21
80 0.21
81 0.21
82 0.23
83 0.27
84 0.27
85 0.26
86 0.26
87 0.29
88 0.29
89 0.28
90 0.28
91 0.25
92 0.25
93 0.28
94 0.25
95 0.23
96 0.24
97 0.24
98 0.21
99 0.22
100 0.2
101 0.16
102 0.16
103 0.15
104 0.14
105 0.14
106 0.14
107 0.12
108 0.11
109 0.09
110 0.09
111 0.07
112 0.08
113 0.08
114 0.09
115 0.1
116 0.1
117 0.1
118 0.1
119 0.12
120 0.12
121 0.12
122 0.1
123 0.1
124 0.09
125 0.11
126 0.11
127 0.09
128 0.11
129 0.11
130 0.12
131 0.13
132 0.16
133 0.16
134 0.18
135 0.22
136 0.24
137 0.28
138 0.29
139 0.32
140 0.29
141 0.28
142 0.27
143 0.24
144 0.2
145 0.2
146 0.19
147 0.16
148 0.18
149 0.18
150 0.17
151 0.17
152 0.16
153 0.12
154 0.14
155 0.14
156 0.13
157 0.15
158 0.17
159 0.23
160 0.26
161 0.26
162 0.29
163 0.32
164 0.33
165 0.32
166 0.29
167 0.23
168 0.22
169 0.2
170 0.15
171 0.11
172 0.08
173 0.07
174 0.06
175 0.07
176 0.05
177 0.06
178 0.06
179 0.08
180 0.08
181 0.09
182 0.09
183 0.08
184 0.08
185 0.07
186 0.07
187 0.05
188 0.04
189 0.04
190 0.04
191 0.04
192 0.04
193 0.06
194 0.07
195 0.07
196 0.07
197 0.09
198 0.09
199 0.09
200 0.1
201 0.08
202 0.1
203 0.1
204 0.11
205 0.09
206 0.09
207 0.09
208 0.1
209 0.12
210 0.17
211 0.19
212 0.21
213 0.22
214 0.22
215 0.23
216 0.25
217 0.23
218 0.17
219 0.18
220 0.16
221 0.25
222 0.29
223 0.32
224 0.38
225 0.44
226 0.44
227 0.42
228 0.44
229 0.38
230 0.37
231 0.43
232 0.43
233 0.39
234 0.4
235 0.41
236 0.38
237 0.35
238 0.31
239 0.22
240 0.12
241 0.09
242 0.08
243 0.06
244 0.08
245 0.08
246 0.08
247 0.08
248 0.09
249 0.1
250 0.09
251 0.1
252 0.09
253 0.1
254 0.1
255 0.1
256 0.08
257 0.08
258 0.09
259 0.09
260 0.09
261 0.08
262 0.1
263 0.1
264 0.1
265 0.11
266 0.11
267 0.11
268 0.15
269 0.18
270 0.26
271 0.27
272 0.28
273 0.28
274 0.27
275 0.28
276 0.25
277 0.23
278 0.13
279 0.12
280 0.11
281 0.11
282 0.1
283 0.09
284 0.07
285 0.05
286 0.05
287 0.04
288 0.06
289 0.08
290 0.08
291 0.08
292 0.08
293 0.08
294 0.09
295 0.1
296 0.07
297 0.07
298 0.08
299 0.1
300 0.1
301 0.1
302 0.1
303 0.12
304 0.12
305 0.12
306 0.12
307 0.1
308 0.11
309 0.11
310 0.1
311 0.09
312 0.08
313 0.09
314 0.09
315 0.08
316 0.08
317 0.08
318 0.11
319 0.13
320 0.13
321 0.12
322 0.17
323 0.18
324 0.19
325 0.2
326 0.18
327 0.17
328 0.17
329 0.17
330 0.13
331 0.14
332 0.14
333 0.13
334 0.13
335 0.13
336 0.12
337 0.12
338 0.13
339 0.13
340 0.15
341 0.13
342 0.17
343 0.18
344 0.25
345 0.29
346 0.3
347 0.32
348 0.34
349 0.35
350 0.31
351 0.3
352 0.27
353 0.24
354 0.23
355 0.19
356 0.15
357 0.14
358 0.13
359 0.12
360 0.08
361 0.06
362 0.05
363 0.04
364 0.04
365 0.04
366 0.04
367 0.05
368 0.06
369 0.06
370 0.06
371 0.06
372 0.06
373 0.07
374 0.07
375 0.07
376 0.07
377 0.07
378 0.08
379 0.07
380 0.08
381 0.11
382 0.11
383 0.11
384 0.12
385 0.12
386 0.11
387 0.12
388 0.13
389 0.15
390 0.19
391 0.27
392 0.28
393 0.31
394 0.33
395 0.39
396 0.43
397 0.42
398 0.39
399 0.34
400 0.32
401 0.3
402 0.3
403 0.24
404 0.19
405 0.15
406 0.14
407 0.11
408 0.11
409 0.1
410 0.08
411 0.07
412 0.07
413 0.06
414 0.06
415 0.05
416 0.05
417 0.05
418 0.04
419 0.04
420 0.04
421 0.04
422 0.04
423 0.05
424 0.05
425 0.06
426 0.08
427 0.1
428 0.12
429 0.12
430 0.13
431 0.15
432 0.17
433 0.18
434 0.18
435 0.17
436 0.17
437 0.16
438 0.16
439 0.14
440 0.12
441 0.13
442 0.12
443 0.12
444 0.12
445 0.12
446 0.12
447 0.14
448 0.13
449 0.11
450 0.1
451 0.1
452 0.09
453 0.11
454 0.1
455 0.09
456 0.09
457 0.1
458 0.09
459 0.08
460 0.08
461 0.06
462 0.06
463 0.06
464 0.06
465 0.06
466 0.07
467 0.07
468 0.07
469 0.08
470 0.08
471 0.08
472 0.08
473 0.08
474 0.07
475 0.07
476 0.08
477 0.07
478 0.09