Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178AUS7

Protein Details
Accession A0A178AUS7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
67-94ELESHPCRFRRCKRLRLGRVRSDNRTFIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9.5, cyto_nucl 7.5, mito 5, cyto 4.5, plas 3, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPLYSPDPINPDTTTGQQWSKEALFGLLGIIAVILAPCVGLLIRCSYLRWCQTRRQESSQKENDIELESHPCRFRRCKRLRLGRVRSDNRTFILVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.25
4 0.26
5 0.24
6 0.25
7 0.25
8 0.23
9 0.21
10 0.18
11 0.15
12 0.12
13 0.11
14 0.1
15 0.06
16 0.05
17 0.04
18 0.04
19 0.03
20 0.03
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.03
30 0.05
31 0.06
32 0.07
33 0.08
34 0.1
35 0.14
36 0.2
37 0.25
38 0.27
39 0.34
40 0.43
41 0.51
42 0.55
43 0.59
44 0.63
45 0.63
46 0.7
47 0.69
48 0.62
49 0.55
50 0.49
51 0.42
52 0.36
53 0.3
54 0.22
55 0.22
56 0.19
57 0.22
58 0.25
59 0.26
60 0.3
61 0.39
62 0.47
63 0.52
64 0.61
65 0.67
66 0.75
67 0.84
68 0.89
69 0.9
70 0.9
71 0.9
72 0.91
73 0.89
74 0.86
75 0.82
76 0.75
77 0.65