Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178AJA4

Protein Details
Accession A0A178AJA4    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
193-222EESMLRRKSTSDKKKEKKEKEKDYYDPVEDBasic
NLS Segment(s)
PositionSequence
199-212RKSTSDKKKEKKEK
Subcellular Location(s) mito 16, nucl 10.5, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MATLAVPSTTSASRRPLSTHGMPKPPRVTSPDRPHRFSGRGISVPEASAGYMSPRTPGPMSPPMSARSIGTFIDSEPSTPAYSPRMDHDWDNSTLVLLRPMSTCSEPGSPSEPVWEMMKPMENTQQAPLPLRIDRKPPTVFTREMAPAPRIASPPTKRSRIPSERKVSIQQETVAPVRKVEHAYKEQKEEGTEESMLRRKSTSDKKKEKKEKEKDYYDPVEDVHWTEM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.33
4 0.39
5 0.45
6 0.51
7 0.52
8 0.6
9 0.61
10 0.66
11 0.67
12 0.62
13 0.58
14 0.55
15 0.56
16 0.57
17 0.65
18 0.68
19 0.68
20 0.7
21 0.71
22 0.71
23 0.66
24 0.59
25 0.57
26 0.52
27 0.49
28 0.46
29 0.43
30 0.37
31 0.34
32 0.3
33 0.22
34 0.15
35 0.11
36 0.09
37 0.09
38 0.09
39 0.09
40 0.1
41 0.1
42 0.13
43 0.14
44 0.15
45 0.19
46 0.26
47 0.29
48 0.3
49 0.32
50 0.31
51 0.32
52 0.32
53 0.26
54 0.19
55 0.17
56 0.15
57 0.15
58 0.13
59 0.11
60 0.14
61 0.13
62 0.12
63 0.11
64 0.13
65 0.12
66 0.12
67 0.13
68 0.12
69 0.13
70 0.14
71 0.16
72 0.18
73 0.19
74 0.2
75 0.22
76 0.23
77 0.23
78 0.23
79 0.2
80 0.16
81 0.16
82 0.15
83 0.13
84 0.09
85 0.08
86 0.08
87 0.09
88 0.11
89 0.11
90 0.11
91 0.12
92 0.13
93 0.13
94 0.14
95 0.16
96 0.15
97 0.14
98 0.15
99 0.14
100 0.13
101 0.14
102 0.12
103 0.09
104 0.09
105 0.13
106 0.12
107 0.13
108 0.18
109 0.18
110 0.19
111 0.19
112 0.21
113 0.18
114 0.19
115 0.19
116 0.16
117 0.17
118 0.21
119 0.21
120 0.26
121 0.28
122 0.33
123 0.34
124 0.35
125 0.38
126 0.39
127 0.38
128 0.32
129 0.34
130 0.29
131 0.29
132 0.28
133 0.23
134 0.2
135 0.2
136 0.21
137 0.17
138 0.18
139 0.25
140 0.27
141 0.35
142 0.4
143 0.43
144 0.43
145 0.48
146 0.56
147 0.58
148 0.63
149 0.65
150 0.67
151 0.67
152 0.69
153 0.7
154 0.63
155 0.57
156 0.5
157 0.41
158 0.34
159 0.33
160 0.33
161 0.32
162 0.28
163 0.25
164 0.24
165 0.26
166 0.29
167 0.3
168 0.34
169 0.37
170 0.46
171 0.49
172 0.53
173 0.53
174 0.5
175 0.47
176 0.41
177 0.35
178 0.3
179 0.27
180 0.22
181 0.25
182 0.29
183 0.29
184 0.28
185 0.25
186 0.24
187 0.33
188 0.43
189 0.49
190 0.54
191 0.65
192 0.74
193 0.84
194 0.93
195 0.94
196 0.94
197 0.94
198 0.94
199 0.93
200 0.92
201 0.87
202 0.86
203 0.81
204 0.73
205 0.63
206 0.52
207 0.44
208 0.36