Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178ACQ8

Protein Details
Accession A0A178ACQ8   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
59-85SPSPSTATKKKTRHQRHDRAGKREKYLBasic
NLS Segment(s)
PositionSequence
66-100TKKKTRHQRHDRAGKREKYLVAGQQPPPRHRKSRK
Subcellular Location(s) nucl 17, mito 5, plas 3
Family & Domain DBs
Amino Acid Sequences MSRHNHSTSIDLPKAPEPSCRSIDLCTMPLQLNVNARSFTLTSPPPRPPRLHPLPSEESPSPSTATKKKTRHQRHDRAGKREKYLVAGQQPPPRHRKSRKDATDLYQTILAAQNERIRGRQHDLIDPNVQEEEEMGHRSALKMNIWQRSLKDQHPRAWTSVSGVGYGQDWGTAKGQGYGGVMYTGPQAITREDMKAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.38
3 0.39
4 0.36
5 0.4
6 0.42
7 0.42
8 0.39
9 0.36
10 0.41
11 0.37
12 0.33
13 0.29
14 0.28
15 0.25
16 0.26
17 0.26
18 0.23
19 0.26
20 0.26
21 0.26
22 0.23
23 0.23
24 0.23
25 0.22
26 0.19
27 0.18
28 0.21
29 0.25
30 0.3
31 0.38
32 0.43
33 0.47
34 0.51
35 0.52
36 0.57
37 0.61
38 0.63
39 0.58
40 0.59
41 0.6
42 0.57
43 0.57
44 0.47
45 0.41
46 0.36
47 0.33
48 0.27
49 0.22
50 0.26
51 0.26
52 0.33
53 0.39
54 0.44
55 0.5
56 0.6
57 0.69
58 0.75
59 0.81
60 0.84
61 0.85
62 0.89
63 0.9
64 0.89
65 0.87
66 0.81
67 0.74
68 0.67
69 0.57
70 0.5
71 0.45
72 0.39
73 0.35
74 0.35
75 0.36
76 0.37
77 0.4
78 0.41
79 0.45
80 0.46
81 0.5
82 0.54
83 0.59
84 0.64
85 0.7
86 0.73
87 0.73
88 0.72
89 0.67
90 0.67
91 0.57
92 0.49
93 0.39
94 0.31
95 0.25
96 0.24
97 0.19
98 0.11
99 0.12
100 0.14
101 0.15
102 0.16
103 0.18
104 0.17
105 0.2
106 0.24
107 0.28
108 0.27
109 0.31
110 0.33
111 0.34
112 0.35
113 0.32
114 0.28
115 0.23
116 0.2
117 0.14
118 0.11
119 0.1
120 0.08
121 0.1
122 0.09
123 0.1
124 0.1
125 0.11
126 0.14
127 0.14
128 0.14
129 0.19
130 0.24
131 0.3
132 0.32
133 0.33
134 0.32
135 0.39
136 0.43
137 0.43
138 0.48
139 0.48
140 0.53
141 0.58
142 0.59
143 0.53
144 0.5
145 0.44
146 0.37
147 0.37
148 0.3
149 0.23
150 0.2
151 0.18
152 0.16
153 0.16
154 0.12
155 0.09
156 0.09
157 0.1
158 0.12
159 0.13
160 0.13
161 0.15
162 0.15
163 0.15
164 0.15
165 0.13
166 0.13
167 0.12
168 0.11
169 0.09
170 0.1
171 0.09
172 0.08
173 0.1
174 0.11
175 0.11
176 0.16
177 0.17