Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178A9S8

Protein Details
Accession A0A178A9S8    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MKRVLGTKRRRKRFKSRRLGENEGDBasic
NLS Segment(s)
PositionSequence
7-18TKRRRKRFKSRR
Subcellular Location(s) nucl 12.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MKRVLGTKRRRKRFKSRRLGENEGDLQVSGGSPTIKNRPALTLQFPCGNLSIGGQSHTATLVLVHAVSCLRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.92
3 0.9
4 0.9
5 0.88
6 0.86
7 0.77
8 0.73
9 0.64
10 0.53
11 0.44
12 0.33
13 0.24
14 0.16
15 0.14
16 0.07
17 0.05
18 0.05
19 0.05
20 0.08
21 0.12
22 0.14
23 0.16
24 0.16
25 0.18
26 0.21
27 0.24
28 0.27
29 0.26
30 0.25
31 0.27
32 0.27
33 0.25
34 0.22
35 0.2
36 0.15
37 0.12
38 0.13
39 0.1
40 0.11
41 0.11
42 0.1
43 0.1
44 0.1
45 0.09
46 0.07
47 0.07
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06