Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178AK75

Protein Details
Accession A0A178AK75   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
107-128KETTKGQAKKRGRPAGKGKAKABasic
NLS Segment(s)
PositionSequence
103-128GRGEKETTKGQAKKRGRPAGKGKAKA
Subcellular Location(s) cyto 11, cyto_nucl 10.5, nucl 8, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029003  CENP-S/Mhf1  
IPR009072  Histone-fold  
Gene Ontology GO:0071821  C:FANCM-MHF complex  
GO:0046982  F:protein heterodimerization activity  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF15630  CENP-S  
Amino Acid Sequences MASNDASAEQEERLKSALWYSIGKYIDEECLTSDVNATPQFIGALTELVYTQIANTSRDLETFSAHAGRSVINTDDVMLLARRNDALEEMLRRELDAIKAGEGRGEKETTKGQAKKRGRPAGKGKAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.16
4 0.19
5 0.17
6 0.18
7 0.19
8 0.24
9 0.24
10 0.24
11 0.23
12 0.21
13 0.22
14 0.2
15 0.19
16 0.14
17 0.15
18 0.15
19 0.14
20 0.13
21 0.1
22 0.12
23 0.12
24 0.12
25 0.1
26 0.1
27 0.1
28 0.09
29 0.09
30 0.06
31 0.06
32 0.05
33 0.06
34 0.06
35 0.06
36 0.06
37 0.05
38 0.04
39 0.07
40 0.08
41 0.09
42 0.1
43 0.12
44 0.12
45 0.12
46 0.14
47 0.11
48 0.11
49 0.1
50 0.1
51 0.09
52 0.09
53 0.09
54 0.08
55 0.08
56 0.07
57 0.08
58 0.08
59 0.07
60 0.07
61 0.07
62 0.07
63 0.07
64 0.07
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.06
72 0.07
73 0.08
74 0.11
75 0.12
76 0.14
77 0.16
78 0.16
79 0.15
80 0.16
81 0.15
82 0.14
83 0.16
84 0.15
85 0.14
86 0.16
87 0.16
88 0.17
89 0.17
90 0.18
91 0.17
92 0.18
93 0.17
94 0.19
95 0.24
96 0.27
97 0.36
98 0.4
99 0.44
100 0.53
101 0.62
102 0.68
103 0.75
104 0.8
105 0.76
106 0.79
107 0.82
108 0.83