Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178AD65

Protein Details
Accession A0A178AD65   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
73-94EIRSSKRRTAVRRTKKLPGFKTHydrophilic
NLS Segment(s)
PositionSequence
78-88KRRTAVRRTKK
Subcellular Location(s) plas 19, mito 5, cyto 1, extr 1, E.R. 1
Family & Domain DBs
Amino Acid Sequences MSFFFTLAMICFAIVSIVSTMAIPISPSHSSTPMPPTWNMQRATSFNAWLGAELKDKDAQSGANKKPLIVDVEIRSSKRRTAVRRTKKLPGFKTVPGPGMQCAVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.05
9 0.05
10 0.05
11 0.05
12 0.09
13 0.1
14 0.12
15 0.14
16 0.16
17 0.17
18 0.19
19 0.24
20 0.22
21 0.24
22 0.23
23 0.26
24 0.31
25 0.36
26 0.35
27 0.31
28 0.32
29 0.31
30 0.35
31 0.31
32 0.25
33 0.19
34 0.19
35 0.17
36 0.15
37 0.14
38 0.1
39 0.11
40 0.1
41 0.11
42 0.12
43 0.12
44 0.12
45 0.11
46 0.12
47 0.16
48 0.25
49 0.25
50 0.29
51 0.3
52 0.29
53 0.3
54 0.3
55 0.27
56 0.2
57 0.22
58 0.18
59 0.25
60 0.27
61 0.27
62 0.29
63 0.28
64 0.29
65 0.32
66 0.38
67 0.39
68 0.48
69 0.58
70 0.66
71 0.74
72 0.78
73 0.81
74 0.82
75 0.84
76 0.78
77 0.76
78 0.7
79 0.64
80 0.67
81 0.61
82 0.56
83 0.48
84 0.45
85 0.37