Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178A9Y6

Protein Details
Accession A0A178A9Y6    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-28GAVKTKSKPAAPKNNRQKGPKPGARHydrophilic
67-86EMLKGGKKDKKDQKDGKKATBasic
NLS Segment(s)
PositionSequence
7-36KTKSKPAAPKNNRQKGPKPGARVIKPKKAS
70-85KGGKKDKKDQKDGKKA
Subcellular Location(s) mito 14, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MAQGAVKTKSKPAAPKNNRQKGPKPGARVIKPKKASLISQNKIMKKNAAGLVGQTEKLLAQKAGHLEMLKGGKKDKKDQKDGKKAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.72
3 0.78
4 0.83
5 0.84
6 0.82
7 0.8
8 0.79
9 0.81
10 0.76
11 0.72
12 0.7
13 0.72
14 0.71
15 0.74
16 0.7
17 0.69
18 0.66
19 0.61
20 0.58
21 0.52
22 0.48
23 0.47
24 0.5
25 0.43
26 0.48
27 0.52
28 0.51
29 0.51
30 0.49
31 0.41
32 0.31
33 0.34
34 0.28
35 0.24
36 0.2
37 0.17
38 0.2
39 0.2
40 0.19
41 0.13
42 0.11
43 0.09
44 0.1
45 0.11
46 0.08
47 0.07
48 0.1
49 0.12
50 0.14
51 0.15
52 0.14
53 0.13
54 0.17
55 0.23
56 0.24
57 0.23
58 0.28
59 0.31
60 0.37
61 0.47
62 0.53
63 0.57
64 0.65
65 0.74
66 0.8