Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178AD62

Protein Details
Accession A0A178AD62    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
21-45ACPVAPRSRPKQPRKPLMSRANPRSHydrophilic
NLS Segment(s)
PositionSequence
29-35RPKQPRK
Subcellular Location(s) nucl 21, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MVDEKASAKMGRSCFPRMNGACPVAPRSRPKQPRKPLMSRANPRSSHCSLHFPRRTRRSARPYHAHTPSMRVSSSYTLCTSATP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.42
3 0.48
4 0.44
5 0.46
6 0.44
7 0.42
8 0.38
9 0.35
10 0.37
11 0.31
12 0.34
13 0.35
14 0.36
15 0.44
16 0.53
17 0.62
18 0.67
19 0.73
20 0.79
21 0.82
22 0.84
23 0.83
24 0.83
25 0.83
26 0.81
27 0.78
28 0.76
29 0.69
30 0.64
31 0.61
32 0.53
33 0.48
34 0.41
35 0.43
36 0.38
37 0.47
38 0.51
39 0.5
40 0.58
41 0.61
42 0.67
43 0.65
44 0.71
45 0.71
46 0.74
47 0.77
48 0.77
49 0.76
50 0.78
51 0.76
52 0.71
53 0.62
54 0.57
55 0.53
56 0.47
57 0.39
58 0.31
59 0.29
60 0.3
61 0.31
62 0.28
63 0.25
64 0.24