Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178AHP9

Protein Details
Accession A0A178AHP9    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
79-107ISTLPRCRQLGKRQPCSSRKPQPPTMQHEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 5.5, cyto_nucl 5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MRAPSCRWVPAGRGLSSTFLHLTHVRPCARCRISQPVLPDLRSGVASRHRCDRAYNHATDLCKCVMGHVLHPSNTPPSISTLPRCRQLGKRQPCSSRKPQPPTMQHE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.33
4 0.31
5 0.23
6 0.17
7 0.19
8 0.18
9 0.2
10 0.22
11 0.28
12 0.29
13 0.31
14 0.33
15 0.4
16 0.41
17 0.42
18 0.42
19 0.45
20 0.45
21 0.45
22 0.47
23 0.45
24 0.44
25 0.41
26 0.36
27 0.27
28 0.24
29 0.21
30 0.18
31 0.13
32 0.19
33 0.22
34 0.24
35 0.3
36 0.31
37 0.31
38 0.33
39 0.35
40 0.36
41 0.37
42 0.37
43 0.32
44 0.33
45 0.34
46 0.32
47 0.3
48 0.21
49 0.17
50 0.15
51 0.13
52 0.16
53 0.16
54 0.17
55 0.21
56 0.24
57 0.23
58 0.24
59 0.25
60 0.22
61 0.22
62 0.2
63 0.14
64 0.16
65 0.2
66 0.22
67 0.28
68 0.34
69 0.38
70 0.44
71 0.46
72 0.46
73 0.51
74 0.59
75 0.63
76 0.64
77 0.71
78 0.73
79 0.8
80 0.83
81 0.84
82 0.83
83 0.83
84 0.83
85 0.81
86 0.82
87 0.83