Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178B7W7

Protein Details
Accession A0A178B7W7    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
34-58YEEIPHPKKPGKMKKVKKDIPAYIPBasic
233-259EMGIPRQESRRQRDERPSRNGTKNSRRHydrophilic
NLS Segment(s)
PositionSequence
40-51PKKPGKMKKVKK
Subcellular Location(s) mito 9.5, cyto_mito 8.833, cyto_nucl 7.833, nucl 7.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR025187  DUF4112  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF13430  DUF4112  
Amino Acid Sequences MTQLVAKYAMKKVLNSELNKYKSKEVSGAYDPYYEEIPHPKKPGKMKKVKKDIPAYIPSQEANILAKARKTAYRLDYALFTFAGIRFGWSAVIGLVPAIGDAADALLAFNLILNMRKVECGLPSSVLLMMMVNLAIDFLVGLVPFIGDLADAAVKCNGKNVRLLERHLDSVYKPEDLKARDAKLPRERRPRPASVYVDFDDEAEERRNTFDSDSDHVRAPQQAYSGRRPHDEEMGIPRQESRRQRDERPSRNGTKNSRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.46
3 0.51
4 0.53
5 0.56
6 0.6
7 0.58
8 0.56
9 0.52
10 0.52
11 0.48
12 0.42
13 0.43
14 0.42
15 0.43
16 0.37
17 0.34
18 0.32
19 0.28
20 0.26
21 0.2
22 0.17
23 0.24
24 0.27
25 0.31
26 0.37
27 0.4
28 0.46
29 0.56
30 0.65
31 0.66
32 0.72
33 0.77
34 0.82
35 0.88
36 0.89
37 0.88
38 0.86
39 0.82
40 0.78
41 0.73
42 0.65
43 0.56
44 0.51
45 0.41
46 0.33
47 0.26
48 0.19
49 0.15
50 0.14
51 0.15
52 0.14
53 0.15
54 0.16
55 0.18
56 0.2
57 0.21
58 0.26
59 0.28
60 0.32
61 0.32
62 0.31
63 0.31
64 0.29
65 0.27
66 0.2
67 0.16
68 0.12
69 0.11
70 0.11
71 0.09
72 0.09
73 0.08
74 0.08
75 0.08
76 0.07
77 0.07
78 0.05
79 0.05
80 0.04
81 0.04
82 0.03
83 0.03
84 0.03
85 0.02
86 0.02
87 0.02
88 0.02
89 0.02
90 0.02
91 0.02
92 0.02
93 0.02
94 0.02
95 0.02
96 0.02
97 0.03
98 0.03
99 0.04
100 0.05
101 0.06
102 0.06
103 0.07
104 0.07
105 0.08
106 0.08
107 0.09
108 0.09
109 0.09
110 0.09
111 0.09
112 0.09
113 0.08
114 0.07
115 0.05
116 0.04
117 0.04
118 0.03
119 0.03
120 0.02
121 0.02
122 0.02
123 0.02
124 0.02
125 0.02
126 0.02
127 0.02
128 0.02
129 0.02
130 0.02
131 0.02
132 0.02
133 0.02
134 0.02
135 0.02
136 0.02
137 0.04
138 0.04
139 0.05
140 0.07
141 0.07
142 0.07
143 0.13
144 0.14
145 0.14
146 0.19
147 0.22
148 0.29
149 0.31
150 0.34
151 0.34
152 0.34
153 0.35
154 0.31
155 0.29
156 0.2
157 0.23
158 0.22
159 0.19
160 0.17
161 0.17
162 0.22
163 0.23
164 0.29
165 0.29
166 0.31
167 0.34
168 0.38
169 0.44
170 0.49
171 0.57
172 0.6
173 0.66
174 0.68
175 0.73
176 0.77
177 0.76
178 0.73
179 0.72
180 0.68
181 0.6
182 0.61
183 0.52
184 0.47
185 0.39
186 0.32
187 0.24
188 0.19
189 0.18
190 0.16
191 0.16
192 0.13
193 0.15
194 0.16
195 0.16
196 0.17
197 0.18
198 0.18
199 0.23
200 0.27
201 0.28
202 0.28
203 0.28
204 0.29
205 0.3
206 0.28
207 0.25
208 0.24
209 0.28
210 0.32
211 0.4
212 0.45
213 0.44
214 0.47
215 0.49
216 0.48
217 0.49
218 0.45
219 0.4
220 0.41
221 0.45
222 0.42
223 0.37
224 0.39
225 0.37
226 0.44
227 0.49
228 0.49
229 0.53
230 0.59
231 0.67
232 0.74
233 0.8
234 0.81
235 0.82
236 0.83
237 0.82
238 0.85
239 0.85