Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178AJE8

Protein Details
Accession A0A178AJE8    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
17-47APKTEEAKAKERKRQYDRKQRKKAAADASNNHydrophilic
NLS Segment(s)
PositionSequence
15-40NKAPKTEEAKAKERKRQYDRKQRKKA
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 5.5, pero 3
Family & Domain DBs
Amino Acid Sequences MAKSNKNRGAAVGENKAPKTEEAKAKERKRQYDRKQRKKAAADASNNNNSSNNNNDDDEDDDDGVRPVPGPPIDDPVEVGEKSLSPSGEIGESLDSGCDNAARSGPVPFADPFAAFFSGMNIVQTDNISFPALPPAPEEKNVQDLIPTRICNSPATRNILDDRQLHNIILQHFGRINGQIPLQSISQIMIGSNLDSTDKAWRKRVQYVLNNSPETFPKTTSRGTAYYSLAPQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.46
3 0.45
4 0.4
5 0.35
6 0.34
7 0.35
8 0.39
9 0.41
10 0.5
11 0.59
12 0.66
13 0.73
14 0.76
15 0.79
16 0.8
17 0.84
18 0.86
19 0.87
20 0.9
21 0.92
22 0.94
23 0.93
24 0.92
25 0.89
26 0.87
27 0.85
28 0.83
29 0.79
30 0.76
31 0.75
32 0.72
33 0.65
34 0.56
35 0.47
36 0.39
37 0.35
38 0.33
39 0.29
40 0.24
41 0.24
42 0.24
43 0.24
44 0.25
45 0.24
46 0.21
47 0.17
48 0.14
49 0.14
50 0.13
51 0.12
52 0.1
53 0.08
54 0.07
55 0.1
56 0.1
57 0.12
58 0.13
59 0.18
60 0.19
61 0.19
62 0.19
63 0.18
64 0.2
65 0.17
66 0.16
67 0.11
68 0.1
69 0.11
70 0.12
71 0.1
72 0.08
73 0.08
74 0.09
75 0.08
76 0.08
77 0.07
78 0.06
79 0.06
80 0.06
81 0.06
82 0.05
83 0.04
84 0.04
85 0.04
86 0.04
87 0.05
88 0.05
89 0.06
90 0.06
91 0.07
92 0.08
93 0.08
94 0.09
95 0.09
96 0.1
97 0.1
98 0.1
99 0.1
100 0.11
101 0.11
102 0.09
103 0.08
104 0.08
105 0.08
106 0.08
107 0.07
108 0.06
109 0.05
110 0.06
111 0.06
112 0.06
113 0.05
114 0.06
115 0.06
116 0.05
117 0.06
118 0.1
119 0.1
120 0.1
121 0.12
122 0.16
123 0.17
124 0.19
125 0.21
126 0.17
127 0.21
128 0.21
129 0.19
130 0.17
131 0.18
132 0.2
133 0.21
134 0.21
135 0.19
136 0.2
137 0.22
138 0.23
139 0.24
140 0.27
141 0.28
142 0.35
143 0.33
144 0.34
145 0.35
146 0.35
147 0.36
148 0.33
149 0.32
150 0.31
151 0.31
152 0.29
153 0.28
154 0.28
155 0.24
156 0.26
157 0.23
158 0.19
159 0.19
160 0.19
161 0.19
162 0.17
163 0.17
164 0.14
165 0.14
166 0.14
167 0.14
168 0.16
169 0.15
170 0.14
171 0.12
172 0.11
173 0.11
174 0.1
175 0.09
176 0.08
177 0.08
178 0.08
179 0.08
180 0.07
181 0.07
182 0.07
183 0.09
184 0.18
185 0.24
186 0.28
187 0.36
188 0.42
189 0.47
190 0.55
191 0.63
192 0.63
193 0.66
194 0.71
195 0.73
196 0.74
197 0.72
198 0.64
199 0.58
200 0.51
201 0.48
202 0.4
203 0.33
204 0.31
205 0.33
206 0.35
207 0.37
208 0.39
209 0.35
210 0.38
211 0.39
212 0.37
213 0.38