Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J5K1C9

Protein Details
Accession J5K1C9   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-33IACSKSLYKAGQKRRNKKRELAAAFHydrophilic
38-57KPGVRHRRSAQPARRPRRVLBasic
NLS Segment(s)
PositionSequence
19-55GQKRRNKKRELAAAFAQGDKPGVRHRRSAQPARRPRR
Subcellular Location(s) mito 12, nucl 6, cyto 5, extr 4
Family & Domain DBs
Amino Acid Sequences MASIIIVVIACSKSLYKAGQKRRNKKRELAAAFAQGDKPGVRHRRSAQPARRPRRVLNNNNGGSHYTATTYSSSNGLVPSRLPEPLEPAESRDDLESLARASTIASESGGGRRRMSDESTLAEVAREGAWTART
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.18
3 0.25
4 0.35
5 0.46
6 0.55
7 0.65
8 0.75
9 0.83
10 0.88
11 0.86
12 0.85
13 0.84
14 0.85
15 0.79
16 0.75
17 0.67
18 0.63
19 0.57
20 0.49
21 0.39
22 0.29
23 0.24
24 0.18
25 0.16
26 0.18
27 0.26
28 0.27
29 0.33
30 0.38
31 0.47
32 0.55
33 0.64
34 0.65
35 0.68
36 0.76
37 0.78
38 0.82
39 0.76
40 0.72
41 0.73
42 0.74
43 0.72
44 0.71
45 0.72
46 0.66
47 0.62
48 0.58
49 0.48
50 0.39
51 0.3
52 0.21
53 0.11
54 0.09
55 0.1
56 0.1
57 0.09
58 0.09
59 0.09
60 0.09
61 0.09
62 0.1
63 0.09
64 0.08
65 0.08
66 0.1
67 0.1
68 0.1
69 0.11
70 0.1
71 0.15
72 0.16
73 0.19
74 0.17
75 0.19
76 0.21
77 0.2
78 0.21
79 0.16
80 0.14
81 0.11
82 0.12
83 0.1
84 0.08
85 0.08
86 0.07
87 0.06
88 0.06
89 0.07
90 0.07
91 0.07
92 0.07
93 0.07
94 0.09
95 0.15
96 0.2
97 0.21
98 0.21
99 0.22
100 0.25
101 0.27
102 0.3
103 0.29
104 0.26
105 0.28
106 0.31
107 0.3
108 0.27
109 0.23
110 0.2
111 0.16
112 0.14
113 0.1
114 0.08