Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178A7H1

Protein Details
Accession A0A178A7H1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
54-82GTYNHGRQTKQERRKRKKEIQKALKEKVWBasic
NLS Segment(s)
PositionSequence
63-96KQERRKRKKEIQKALKEKVWPKKPELVGRRRGAK
Subcellular Location(s) plas 15, mito 4, pero 3, E.R. 2, cyto_pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPAALPLMAISVFVPTLIAHYMPPTSVTEVACVFIIILALSTTAVSYLAKGMSGTYNHGRQTKQERRKRKKEIQKALKEKVWPKKPELVGRRRGAKIEVMSGGIGTYPDEENDDKTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.07
4 0.07
5 0.08
6 0.07
7 0.09
8 0.09
9 0.09
10 0.11
11 0.11
12 0.13
13 0.15
14 0.15
15 0.15
16 0.15
17 0.16
18 0.14
19 0.12
20 0.09
21 0.06
22 0.06
23 0.04
24 0.04
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.04
32 0.03
33 0.04
34 0.04
35 0.04
36 0.05
37 0.05
38 0.05
39 0.07
40 0.07
41 0.11
42 0.13
43 0.16
44 0.18
45 0.21
46 0.21
47 0.24
48 0.34
49 0.41
50 0.48
51 0.54
52 0.63
53 0.71
54 0.82
55 0.87
56 0.87
57 0.88
58 0.88
59 0.91
60 0.91
61 0.91
62 0.89
63 0.85
64 0.78
65 0.74
66 0.71
67 0.7
68 0.68
69 0.61
70 0.57
71 0.6
72 0.62
73 0.65
74 0.67
75 0.66
76 0.66
77 0.69
78 0.72
79 0.66
80 0.62
81 0.54
82 0.5
83 0.43
84 0.38
85 0.32
86 0.25
87 0.23
88 0.21
89 0.19
90 0.13
91 0.11
92 0.07
93 0.08
94 0.07
95 0.08
96 0.12
97 0.13