Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178AH09

Protein Details
Accession A0A178AH09    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
78-104KKEYEEKQKLKREKRKGKEKEKDKASEBasic
NLS Segment(s)
PositionSequence
76-103KVKKEYEEKQKLKREKRKGKEKEKDKAS
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MENTWHLRRVADNASKACWICYKPTTSVLITPNNKDFFYICPGHLVDRGFCQPDADEAAAVEAKKKKDELDAEIEKVKKEYEEKQKLKREKRKGKEKEKDKASEKESQSKDEEEDKQDEKAKDDKIKELTKSKEKSQAELGPRIYHLNKSFYQMRLDKIRNAEVARRNRERLSNPANFPSVPSGNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.45
3 0.43
4 0.39
5 0.35
6 0.29
7 0.29
8 0.32
9 0.34
10 0.33
11 0.37
12 0.39
13 0.36
14 0.39
15 0.38
16 0.42
17 0.41
18 0.43
19 0.45
20 0.43
21 0.41
22 0.37
23 0.33
24 0.26
25 0.29
26 0.27
27 0.21
28 0.22
29 0.23
30 0.23
31 0.25
32 0.23
33 0.18
34 0.19
35 0.22
36 0.21
37 0.2
38 0.19
39 0.16
40 0.17
41 0.19
42 0.15
43 0.12
44 0.1
45 0.11
46 0.11
47 0.11
48 0.14
49 0.15
50 0.15
51 0.17
52 0.18
53 0.18
54 0.23
55 0.26
56 0.26
57 0.31
58 0.32
59 0.33
60 0.36
61 0.35
62 0.29
63 0.27
64 0.22
65 0.15
66 0.16
67 0.22
68 0.3
69 0.4
70 0.46
71 0.55
72 0.63
73 0.71
74 0.78
75 0.8
76 0.8
77 0.8
78 0.84
79 0.86
80 0.87
81 0.89
82 0.89
83 0.88
84 0.86
85 0.82
86 0.8
87 0.74
88 0.71
89 0.63
90 0.62
91 0.56
92 0.56
93 0.5
94 0.46
95 0.43
96 0.37
97 0.35
98 0.32
99 0.33
100 0.27
101 0.3
102 0.27
103 0.28
104 0.33
105 0.32
106 0.29
107 0.31
108 0.33
109 0.35
110 0.36
111 0.39
112 0.4
113 0.44
114 0.45
115 0.48
116 0.5
117 0.53
118 0.55
119 0.54
120 0.56
121 0.53
122 0.51
123 0.51
124 0.51
125 0.47
126 0.49
127 0.46
128 0.38
129 0.38
130 0.4
131 0.34
132 0.33
133 0.31
134 0.3
135 0.29
136 0.34
137 0.38
138 0.35
139 0.42
140 0.38
141 0.4
142 0.45
143 0.47
144 0.46
145 0.46
146 0.48
147 0.45
148 0.45
149 0.48
150 0.47
151 0.54
152 0.58
153 0.6
154 0.61
155 0.6
156 0.65
157 0.62
158 0.63
159 0.62
160 0.62
161 0.6
162 0.6
163 0.59
164 0.51
165 0.48
166 0.45