Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178B5U6

Protein Details
Accession A0A178B5U6    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-26NSNNRRSWLPWARRDRKMNNDEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 12, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR034110  LSMD1_Sm  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0031417  C:NatC complex  
Pfam View protein in Pfam  
PF01423  LSM  
CDD cd06168  LSMD1  
Amino Acid Sequences MALLNSNNRRSWLPWARRDRKMNNDEATFWLSQFIGKNLRIHASDGRVFGGQMKCTDKDRNIILALAHEYRAPSAEVIRKAIEDSGNPSASVPWNSRYVGLIVVPGQHITKIEFEESTLPGQKSTVVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.65
3 0.71
4 0.77
5 0.84
6 0.82
7 0.82
8 0.8
9 0.78
10 0.73
11 0.66
12 0.59
13 0.53
14 0.48
15 0.38
16 0.31
17 0.23
18 0.17
19 0.17
20 0.16
21 0.15
22 0.17
23 0.19
24 0.21
25 0.21
26 0.24
27 0.23
28 0.25
29 0.25
30 0.24
31 0.24
32 0.23
33 0.23
34 0.2
35 0.19
36 0.21
37 0.2
38 0.17
39 0.17
40 0.19
41 0.2
42 0.23
43 0.26
44 0.22
45 0.24
46 0.24
47 0.24
48 0.21
49 0.2
50 0.17
51 0.14
52 0.15
53 0.12
54 0.1
55 0.08
56 0.08
57 0.07
58 0.08
59 0.08
60 0.06
61 0.09
62 0.13
63 0.14
64 0.16
65 0.16
66 0.16
67 0.16
68 0.17
69 0.15
70 0.11
71 0.15
72 0.18
73 0.18
74 0.17
75 0.17
76 0.17
77 0.18
78 0.21
79 0.18
80 0.16
81 0.18
82 0.19
83 0.2
84 0.19
85 0.18
86 0.16
87 0.14
88 0.13
89 0.1
90 0.11
91 0.11
92 0.11
93 0.1
94 0.1
95 0.11
96 0.11
97 0.13
98 0.14
99 0.15
100 0.14
101 0.15
102 0.18
103 0.19
104 0.22
105 0.25
106 0.23
107 0.22
108 0.22