Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178AF67

Protein Details
Accession A0A178AF67   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
72-92LEQHPAFRNEKKSKRHFRFRVBasic
NLS Segment(s)
PositionSequence
83-86KSKR
Subcellular Location(s) cyto 14.5, cyto_nucl 11, nucl 6.5, mito 4
Family & Domain DBs
Amino Acid Sequences MASIILLAGVAIYYSAEKIHERNEKKRELKALQGLLHGPVEEVWRDDDAKTTIDHEHTTVDDKERLPSHPALEQHPAFRNEKKSKRHFRFRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.06
4 0.08
5 0.1
6 0.18
7 0.27
8 0.34
9 0.43
10 0.5
11 0.58
12 0.61
13 0.65
14 0.65
15 0.59
16 0.6
17 0.58
18 0.55
19 0.47
20 0.44
21 0.39
22 0.32
23 0.29
24 0.21
25 0.14
26 0.09
27 0.09
28 0.07
29 0.07
30 0.07
31 0.08
32 0.09
33 0.09
34 0.1
35 0.1
36 0.1
37 0.1
38 0.11
39 0.11
40 0.12
41 0.13
42 0.12
43 0.11
44 0.11
45 0.15
46 0.14
47 0.16
48 0.17
49 0.18
50 0.22
51 0.22
52 0.24
53 0.25
54 0.26
55 0.25
56 0.26
57 0.28
58 0.28
59 0.34
60 0.33
61 0.34
62 0.38
63 0.4
64 0.39
65 0.43
66 0.5
67 0.53
68 0.6
69 0.66
70 0.7
71 0.78
72 0.84