Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178AMG5

Protein Details
Accession A0A178AMG5    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
126-152DSDAHPLKRSHRERKRRPSQSAPYVYTHydrophilic
NLS Segment(s)
PositionSequence
119-143RASRHRRDSDAHPLKRSHRERKRRP
210-234SRPRRASGTGRAQPTTPKKPAAPKP
Subcellular Location(s) nucl 12cyto_nucl 12, cyto 10, mito 3
Family & Domain DBs
Amino Acid Sequences MYAPQFQAPPPGYSMPFDFHHRTTPPMSPGPGQNYYSPRHGPQFASPSPRTSPKVQGYGHTRRASHAVPPQYSQGMPRGAAYDSGIPTSRAYATPRGTPGATPEYVSGFDYYNYVRPSRASRHRRDSDAHPLKRSHRERKRRPSQSAPYVYTKVVYDENGYGYECDYEYDNTYDESPPPPYEQYARHAMYRDTDRDYYDQMPIYDEPKASRPRRASGTGRAQPTTPKKPAAPKPTSKATEEDARRAGIPAGYSYKNWDPSEEPIMLLGSVFDANSLGKWIYDWTVFYNGPATPLAEMAGELWLLLIQLAGKVKRAEETMPKIRKKESHEMVEDFLESGERLWIRFAKLLKVCEDYMWKAAKKENGEKKPVSMGKNSGREFVDSIFGRDRELEKTEKLMTGMRLWSMRFDANCDDILRHPTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.29
3 0.29
4 0.34
5 0.35
6 0.33
7 0.38
8 0.38
9 0.4
10 0.41
11 0.44
12 0.43
13 0.43
14 0.44
15 0.41
16 0.46
17 0.48
18 0.49
19 0.45
20 0.45
21 0.45
22 0.46
23 0.48
24 0.46
25 0.43
26 0.44
27 0.46
28 0.42
29 0.45
30 0.5
31 0.48
32 0.53
33 0.5
34 0.49
35 0.5
36 0.54
37 0.51
38 0.47
39 0.52
40 0.51
41 0.57
42 0.54
43 0.57
44 0.59
45 0.64
46 0.68
47 0.63
48 0.56
49 0.5
50 0.54
51 0.48
52 0.46
53 0.44
54 0.43
55 0.4
56 0.42
57 0.43
58 0.4
59 0.39
60 0.34
61 0.31
62 0.26
63 0.24
64 0.23
65 0.21
66 0.19
67 0.2
68 0.19
69 0.18
70 0.16
71 0.17
72 0.17
73 0.16
74 0.16
75 0.17
76 0.17
77 0.15
78 0.18
79 0.23
80 0.25
81 0.29
82 0.3
83 0.31
84 0.3
85 0.28
86 0.29
87 0.28
88 0.25
89 0.22
90 0.2
91 0.19
92 0.2
93 0.2
94 0.16
95 0.12
96 0.11
97 0.12
98 0.13
99 0.16
100 0.17
101 0.17
102 0.16
103 0.18
104 0.24
105 0.32
106 0.41
107 0.46
108 0.54
109 0.64
110 0.68
111 0.71
112 0.7
113 0.67
114 0.68
115 0.68
116 0.63
117 0.58
118 0.57
119 0.59
120 0.64
121 0.67
122 0.67
123 0.67
124 0.74
125 0.8
126 0.87
127 0.91
128 0.91
129 0.89
130 0.89
131 0.88
132 0.87
133 0.83
134 0.76
135 0.7
136 0.62
137 0.54
138 0.45
139 0.35
140 0.27
141 0.2
142 0.17
143 0.14
144 0.12
145 0.13
146 0.13
147 0.13
148 0.11
149 0.1
150 0.1
151 0.08
152 0.07
153 0.08
154 0.08
155 0.1
156 0.1
157 0.1
158 0.1
159 0.12
160 0.12
161 0.12
162 0.12
163 0.13
164 0.13
165 0.15
166 0.15
167 0.15
168 0.17
169 0.19
170 0.21
171 0.26
172 0.26
173 0.26
174 0.27
175 0.26
176 0.27
177 0.29
178 0.27
179 0.24
180 0.24
181 0.24
182 0.24
183 0.26
184 0.23
185 0.21
186 0.19
187 0.15
188 0.17
189 0.16
190 0.15
191 0.14
192 0.13
193 0.12
194 0.17
195 0.26
196 0.26
197 0.32
198 0.34
199 0.36
200 0.41
201 0.46
202 0.44
203 0.43
204 0.51
205 0.5
206 0.49
207 0.46
208 0.42
209 0.43
210 0.46
211 0.45
212 0.38
213 0.35
214 0.36
215 0.45
216 0.53
217 0.56
218 0.56
219 0.54
220 0.56
221 0.62
222 0.61
223 0.54
224 0.48
225 0.41
226 0.42
227 0.38
228 0.36
229 0.29
230 0.27
231 0.26
232 0.24
233 0.22
234 0.14
235 0.12
236 0.11
237 0.13
238 0.14
239 0.14
240 0.17
241 0.2
242 0.25
243 0.25
244 0.25
245 0.23
246 0.25
247 0.3
248 0.25
249 0.22
250 0.16
251 0.16
252 0.14
253 0.12
254 0.08
255 0.05
256 0.04
257 0.04
258 0.04
259 0.04
260 0.04
261 0.04
262 0.06
263 0.05
264 0.05
265 0.05
266 0.06
267 0.08
268 0.09
269 0.09
270 0.1
271 0.15
272 0.15
273 0.15
274 0.16
275 0.14
276 0.15
277 0.15
278 0.13
279 0.09
280 0.09
281 0.09
282 0.07
283 0.07
284 0.06
285 0.06
286 0.05
287 0.04
288 0.04
289 0.04
290 0.04
291 0.03
292 0.03
293 0.03
294 0.05
295 0.08
296 0.09
297 0.12
298 0.13
299 0.13
300 0.15
301 0.17
302 0.2
303 0.25
304 0.33
305 0.41
306 0.49
307 0.53
308 0.54
309 0.58
310 0.6
311 0.6
312 0.63
313 0.6
314 0.6
315 0.6
316 0.6
317 0.56
318 0.51
319 0.43
320 0.32
321 0.24
322 0.16
323 0.11
324 0.09
325 0.11
326 0.1
327 0.1
328 0.12
329 0.15
330 0.17
331 0.21
332 0.22
333 0.27
334 0.32
335 0.35
336 0.35
337 0.37
338 0.35
339 0.34
340 0.37
341 0.31
342 0.33
343 0.36
344 0.34
345 0.33
346 0.38
347 0.41
348 0.44
349 0.51
350 0.56
351 0.58
352 0.65
353 0.63
354 0.61
355 0.65
356 0.64
357 0.58
358 0.53
359 0.53
360 0.54
361 0.61
362 0.59
363 0.54
364 0.49
365 0.47
366 0.43
367 0.36
368 0.35
369 0.26
370 0.29
371 0.3
372 0.29
373 0.28
374 0.3
375 0.31
376 0.27
377 0.31
378 0.31
379 0.27
380 0.32
381 0.34
382 0.32
383 0.31
384 0.31
385 0.29
386 0.3
387 0.3
388 0.29
389 0.29
390 0.28
391 0.3
392 0.29
393 0.31
394 0.27
395 0.29
396 0.3
397 0.3
398 0.32
399 0.3
400 0.29
401 0.27