Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J5K9R7

Protein Details
Accession J5K9R7    Localization Confidence High Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
114-138APPVEEKKERKKRTHDPNAPKRPLTBasic
274-300ETPKAGPASPDKKRRRTSTKAADDKDDHydrophilic
NLS Segment(s)
PositionSequence
120-128KKERKKRTH
254-268TPKKAAGGRKRKSDA
275-310TPKAGPASPDKKRRRTSTKAADDKDDSKKSARKNKK
Subcellular Location(s) nucl 18.5, cyto_nucl 10, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences MPRPSKKADDKAKGVIPPPTMVIPPVIAGLAPPVNPSVGPRVVDNESFMRVRDSAVNRLSTILELLRSFTSDYIRQTSLLLGEQQGDVNELINSFDPAAAAAQLMLQPVGDLAAPPVEEKKERKKRTHDPNAPKRPLTPYFLYMQHARSIIANDLGLEAPKGAVQEEGQRRWANMSPHEKQGWNNAYQYNLRLYNARVHSYKAQNANAKNMTDEEALKYAEEFSIPMPDLKDASKTDNVQAAIAEQLQDDSSKTPKKAAGGRKRKSDAPVTEVETPKAGPASPDKKRRRTSTKAADDKDDSKKSARKNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.58
3 0.49
4 0.41
5 0.38
6 0.32
7 0.27
8 0.24
9 0.22
10 0.16
11 0.14
12 0.13
13 0.11
14 0.08
15 0.08
16 0.1
17 0.11
18 0.1
19 0.11
20 0.11
21 0.11
22 0.12
23 0.14
24 0.17
25 0.18
26 0.19
27 0.19
28 0.23
29 0.26
30 0.26
31 0.27
32 0.23
33 0.24
34 0.23
35 0.23
36 0.21
37 0.18
38 0.19
39 0.24
40 0.25
41 0.29
42 0.32
43 0.34
44 0.31
45 0.32
46 0.31
47 0.23
48 0.21
49 0.14
50 0.12
51 0.11
52 0.13
53 0.12
54 0.12
55 0.12
56 0.12
57 0.15
58 0.16
59 0.19
60 0.22
61 0.22
62 0.22
63 0.21
64 0.21
65 0.19
66 0.17
67 0.15
68 0.11
69 0.12
70 0.11
71 0.11
72 0.1
73 0.1
74 0.09
75 0.09
76 0.08
77 0.07
78 0.07
79 0.07
80 0.08
81 0.06
82 0.06
83 0.06
84 0.06
85 0.06
86 0.05
87 0.05
88 0.04
89 0.04
90 0.05
91 0.05
92 0.05
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.03
99 0.03
100 0.04
101 0.04
102 0.05
103 0.07
104 0.08
105 0.12
106 0.17
107 0.28
108 0.38
109 0.46
110 0.53
111 0.61
112 0.7
113 0.78
114 0.84
115 0.83
116 0.84
117 0.87
118 0.9
119 0.85
120 0.75
121 0.66
122 0.61
123 0.54
124 0.48
125 0.39
126 0.3
127 0.3
128 0.3
129 0.31
130 0.26
131 0.24
132 0.21
133 0.19
134 0.17
135 0.14
136 0.14
137 0.12
138 0.11
139 0.09
140 0.07
141 0.07
142 0.07
143 0.06
144 0.05
145 0.04
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.05
152 0.13
153 0.18
154 0.19
155 0.22
156 0.23
157 0.23
158 0.25
159 0.28
160 0.23
161 0.26
162 0.33
163 0.32
164 0.36
165 0.38
166 0.37
167 0.34
168 0.4
169 0.37
170 0.31
171 0.31
172 0.27
173 0.28
174 0.27
175 0.28
176 0.22
177 0.2
178 0.18
179 0.17
180 0.18
181 0.23
182 0.25
183 0.27
184 0.24
185 0.26
186 0.32
187 0.35
188 0.39
189 0.37
190 0.4
191 0.43
192 0.44
193 0.48
194 0.44
195 0.39
196 0.35
197 0.3
198 0.27
199 0.22
200 0.22
201 0.16
202 0.15
203 0.15
204 0.14
205 0.13
206 0.11
207 0.1
208 0.09
209 0.07
210 0.06
211 0.1
212 0.1
213 0.11
214 0.11
215 0.12
216 0.13
217 0.13
218 0.17
219 0.15
220 0.19
221 0.23
222 0.24
223 0.26
224 0.29
225 0.29
226 0.25
227 0.24
228 0.19
229 0.16
230 0.14
231 0.12
232 0.07
233 0.08
234 0.08
235 0.08
236 0.08
237 0.09
238 0.16
239 0.21
240 0.22
241 0.25
242 0.27
243 0.33
244 0.41
245 0.5
246 0.54
247 0.6
248 0.66
249 0.73
250 0.75
251 0.74
252 0.71
253 0.7
254 0.64
255 0.58
256 0.56
257 0.51
258 0.54
259 0.51
260 0.46
261 0.38
262 0.33
263 0.28
264 0.24
265 0.19
266 0.15
267 0.23
268 0.31
269 0.39
270 0.5
271 0.58
272 0.68
273 0.77
274 0.84
275 0.84
276 0.84
277 0.86
278 0.86
279 0.87
280 0.87
281 0.82
282 0.79
283 0.75
284 0.73
285 0.71
286 0.65
287 0.57
288 0.55
289 0.57
290 0.6