Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178AAL1

Protein Details
Accession A0A178AAL1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
3-49AAKKHVPIVKKHTKRFNRHQSDRFKCVDPSWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
34-50RKPKGIDNRVRRRFKGQ
Subcellular Location(s) mito 16.5, mito_nucl 10.666, cyto 7, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAAKKHVPIVKKHTKRFNRHQSDRFKCVDPSWRKPKGIDNRVRRRFKGQAAMPKIGYGSNRKTRHLMPSGHKAFLVANVADVDLLLMHNTTFAAEIAHSVSARKRIEIVARAKQLGVKVTNGKARVKTES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.79
3 0.84
4 0.87
5 0.89
6 0.88
7 0.89
8 0.89
9 0.89
10 0.87
11 0.83
12 0.76
13 0.68
14 0.59
15 0.53
16 0.55
17 0.52
18 0.54
19 0.58
20 0.61
21 0.59
22 0.59
23 0.65
24 0.65
25 0.67
26 0.67
27 0.68
28 0.72
29 0.8
30 0.84
31 0.77
32 0.73
33 0.69
34 0.65
35 0.63
36 0.58
37 0.58
38 0.57
39 0.57
40 0.5
41 0.43
42 0.38
43 0.3
44 0.26
45 0.22
46 0.23
47 0.3
48 0.32
49 0.33
50 0.36
51 0.37
52 0.42
53 0.42
54 0.41
55 0.36
56 0.44
57 0.45
58 0.43
59 0.41
60 0.34
61 0.28
62 0.24
63 0.22
64 0.11
65 0.09
66 0.09
67 0.09
68 0.08
69 0.08
70 0.06
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.04
79 0.04
80 0.04
81 0.05
82 0.04
83 0.05
84 0.06
85 0.08
86 0.08
87 0.08
88 0.11
89 0.18
90 0.19
91 0.19
92 0.19
93 0.22
94 0.28
95 0.35
96 0.4
97 0.42
98 0.45
99 0.45
100 0.44
101 0.43
102 0.39
103 0.37
104 0.32
105 0.28
106 0.31
107 0.35
108 0.41
109 0.42
110 0.45
111 0.45