Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178B9L6

Protein Details
Accession A0A178B9L6    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
70-90GYVNLRRKRKFSRKLQYQAVSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 11.5, cyto 9.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010730  HET  
Pfam View protein in Pfam  
PF06985  HET  
Amino Acid Sequences MDQEKSFVDVGPPPRDFYDETEKTDKHFLPFRGVENDTPAYLPLNPKIKQIRYVAVDPGFGDEPISCFLGYVNLRRKRKFSRKLQYQAVSYFWGSIDDTVEITLRCAKRKVTRNLEALLRAFRLRNTHRILWIDAICINQADAAEKTHQVGDMSSIYSAASDVLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.35
3 0.34
4 0.35
5 0.39
6 0.34
7 0.4
8 0.44
9 0.43
10 0.43
11 0.48
12 0.43
13 0.38
14 0.41
15 0.37
16 0.38
17 0.41
18 0.42
19 0.4
20 0.41
21 0.37
22 0.35
23 0.35
24 0.27
25 0.24
26 0.21
27 0.16
28 0.16
29 0.17
30 0.18
31 0.24
32 0.24
33 0.31
34 0.38
35 0.38
36 0.43
37 0.43
38 0.43
39 0.4
40 0.41
41 0.39
42 0.32
43 0.31
44 0.24
45 0.24
46 0.19
47 0.14
48 0.13
49 0.08
50 0.09
51 0.1
52 0.1
53 0.07
54 0.07
55 0.07
56 0.12
57 0.13
58 0.18
59 0.26
60 0.34
61 0.38
62 0.4
63 0.46
64 0.51
65 0.61
66 0.65
67 0.66
68 0.69
69 0.75
70 0.81
71 0.83
72 0.76
73 0.67
74 0.59
75 0.5
76 0.4
77 0.3
78 0.23
79 0.15
80 0.12
81 0.1
82 0.08
83 0.08
84 0.06
85 0.06
86 0.06
87 0.07
88 0.06
89 0.07
90 0.12
91 0.13
92 0.15
93 0.17
94 0.22
95 0.3
96 0.4
97 0.49
98 0.53
99 0.59
100 0.61
101 0.62
102 0.6
103 0.54
104 0.46
105 0.38
106 0.3
107 0.24
108 0.21
109 0.2
110 0.25
111 0.27
112 0.33
113 0.38
114 0.4
115 0.43
116 0.45
117 0.45
118 0.43
119 0.39
120 0.32
121 0.27
122 0.24
123 0.2
124 0.17
125 0.14
126 0.1
127 0.09
128 0.1
129 0.1
130 0.12
131 0.13
132 0.14
133 0.16
134 0.16
135 0.17
136 0.15
137 0.14
138 0.15
139 0.15
140 0.15
141 0.13
142 0.13
143 0.11
144 0.11
145 0.1