Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178B752

Protein Details
Accession A0A178B752   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
282-316VDLVRKREMKLKRRLYDRERRAKRAARKQAGMRGABasic
NLS Segment(s)
PositionSequence
278-316RRKFVDLVRKREMKLKRRLYDRERRAKRAARKQAGMRGA
Subcellular Location(s) mito 16, nucl 8.5, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MRMPPHGRNLAASQALKIRIPKAIWNAYETPTKRITRSSVSTLSCSFPSASHTTDPQDIAANTQPNTSAVNFEEPTTKRIRRTDCKVKLWIFHYGGSRRVMKGKVTNQIEYDTPCLQRTCKTCMIWHPHLLYEQDPAGESSRQQSYHKPAIDIEPIKPDIEPISPDIDPRILDGTWQIYQSRRGSATSTRSLVQPTIITTPELTPVKPLFTGNLQPLDISVGPHPALNDIPLASGCTVCLPVSLVTQAVATTSSRSRWRTIPREQYMVRVIFLSREGRRKFVDLVRKREMKLKRRLYDRERRAKRAARKQAGMRGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.34
4 0.35
5 0.31
6 0.3
7 0.31
8 0.35
9 0.38
10 0.44
11 0.43
12 0.45
13 0.46
14 0.43
15 0.51
16 0.46
17 0.42
18 0.42
19 0.44
20 0.4
21 0.42
22 0.44
23 0.43
24 0.47
25 0.49
26 0.48
27 0.48
28 0.49
29 0.46
30 0.44
31 0.36
32 0.32
33 0.26
34 0.19
35 0.22
36 0.22
37 0.22
38 0.22
39 0.24
40 0.26
41 0.28
42 0.28
43 0.23
44 0.24
45 0.21
46 0.21
47 0.24
48 0.24
49 0.22
50 0.22
51 0.21
52 0.18
53 0.21
54 0.18
55 0.15
56 0.13
57 0.18
58 0.18
59 0.18
60 0.25
61 0.24
62 0.27
63 0.32
64 0.34
65 0.35
66 0.42
67 0.5
68 0.52
69 0.61
70 0.69
71 0.7
72 0.74
73 0.76
74 0.72
75 0.68
76 0.62
77 0.6
78 0.51
79 0.45
80 0.45
81 0.39
82 0.4
83 0.38
84 0.37
85 0.31
86 0.34
87 0.32
88 0.3
89 0.35
90 0.38
91 0.43
92 0.44
93 0.44
94 0.4
95 0.4
96 0.37
97 0.31
98 0.29
99 0.22
100 0.2
101 0.2
102 0.2
103 0.19
104 0.23
105 0.25
106 0.28
107 0.31
108 0.31
109 0.32
110 0.39
111 0.47
112 0.46
113 0.47
114 0.41
115 0.36
116 0.37
117 0.35
118 0.27
119 0.2
120 0.16
121 0.12
122 0.11
123 0.11
124 0.11
125 0.1
126 0.1
127 0.11
128 0.13
129 0.15
130 0.16
131 0.2
132 0.25
133 0.32
134 0.32
135 0.3
136 0.28
137 0.29
138 0.34
139 0.31
140 0.25
141 0.21
142 0.21
143 0.21
144 0.19
145 0.17
146 0.12
147 0.11
148 0.11
149 0.09
150 0.11
151 0.11
152 0.11
153 0.12
154 0.11
155 0.11
156 0.1
157 0.11
158 0.08
159 0.08
160 0.09
161 0.1
162 0.11
163 0.11
164 0.12
165 0.11
166 0.17
167 0.18
168 0.2
169 0.18
170 0.18
171 0.2
172 0.24
173 0.29
174 0.27
175 0.27
176 0.26
177 0.26
178 0.26
179 0.24
180 0.2
181 0.14
182 0.12
183 0.13
184 0.13
185 0.12
186 0.12
187 0.12
188 0.17
189 0.17
190 0.15
191 0.16
192 0.17
193 0.18
194 0.17
195 0.17
196 0.13
197 0.15
198 0.19
199 0.18
200 0.2
201 0.18
202 0.17
203 0.17
204 0.18
205 0.16
206 0.13
207 0.11
208 0.11
209 0.11
210 0.12
211 0.12
212 0.1
213 0.1
214 0.1
215 0.1
216 0.08
217 0.08
218 0.08
219 0.09
220 0.08
221 0.08
222 0.07
223 0.07
224 0.08
225 0.07
226 0.07
227 0.07
228 0.08
229 0.09
230 0.09
231 0.09
232 0.08
233 0.08
234 0.08
235 0.07
236 0.07
237 0.07
238 0.09
239 0.11
240 0.15
241 0.22
242 0.25
243 0.28
244 0.35
245 0.45
246 0.5
247 0.59
248 0.65
249 0.64
250 0.7
251 0.67
252 0.65
253 0.62
254 0.55
255 0.45
256 0.35
257 0.3
258 0.23
259 0.26
260 0.27
261 0.26
262 0.34
263 0.35
264 0.39
265 0.41
266 0.43
267 0.46
268 0.47
269 0.53
270 0.52
271 0.59
272 0.64
273 0.67
274 0.65
275 0.67
276 0.69
277 0.68
278 0.7
279 0.72
280 0.71
281 0.75
282 0.84
283 0.86
284 0.87
285 0.88
286 0.88
287 0.86
288 0.86
289 0.86
290 0.85
291 0.86
292 0.86
293 0.87
294 0.85
295 0.84
296 0.85