Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178ARR9

Protein Details
Accession A0A178ARR9    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
67-91DGPVSAKKPKRVKERQREEMKAREKBasic
NLS Segment(s)
PositionSequence
72-113AKKPKRVKERQREEMKAREKDERGDERRSGGEEEEAGKAGGG
Subcellular Location(s) mito 17.5, cyto_mito 11, nucl 5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPKSCTLCHTPRPVLVRCQIDDSAQWHFVCPGACWKSVSGGVEDAKGLEGQYPYYRYGGMWKDRTADGPVSAKKPKRVKERQREEMKAREKDERGDERRSGGEEEEAGKAGGGKAEKEAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.57
3 0.54
4 0.47
5 0.48
6 0.43
7 0.38
8 0.36
9 0.32
10 0.29
11 0.27
12 0.25
13 0.21
14 0.2
15 0.21
16 0.19
17 0.17
18 0.21
19 0.21
20 0.22
21 0.22
22 0.22
23 0.23
24 0.24
25 0.24
26 0.16
27 0.16
28 0.15
29 0.15
30 0.14
31 0.12
32 0.1
33 0.09
34 0.08
35 0.07
36 0.07
37 0.07
38 0.09
39 0.11
40 0.12
41 0.12
42 0.12
43 0.1
44 0.15
45 0.19
46 0.23
47 0.24
48 0.23
49 0.25
50 0.25
51 0.27
52 0.24
53 0.2
54 0.16
55 0.18
56 0.2
57 0.22
58 0.28
59 0.29
60 0.36
61 0.42
62 0.49
63 0.55
64 0.64
65 0.71
66 0.76
67 0.83
68 0.86
69 0.88
70 0.87
71 0.82
72 0.81
73 0.79
74 0.74
75 0.67
76 0.64
77 0.56
78 0.54
79 0.57
80 0.57
81 0.53
82 0.53
83 0.51
84 0.46
85 0.46
86 0.44
87 0.37
88 0.28
89 0.25
90 0.2
91 0.21
92 0.2
93 0.18
94 0.16
95 0.13
96 0.13
97 0.11
98 0.13
99 0.12
100 0.11