Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178AV65

Protein Details
Accession A0A178AV65    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
151-171RIKHSRDTGLRPKNQRKIAKABasic
NLS Segment(s)
PositionSequence
161-174RPKNQRKIAKAIRR
Subcellular Location(s) mito 21.5, cyto_mito 12.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001648  Ribosomal_S18  
IPR036870  Ribosomal_S18_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01084  Ribosomal_S18  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MLLTRLPLRATFASSPASSSCLRCFSTGPQKQNDGLLSILGNSAAARKPSAESSRNSLAMRHAQDAGLDRTTPSQEVVESERRSNFQRQIYRRWKPGDVYSPSDLSGAEQKKWKVGRAKPTADAFDVLGINPVSEYKNFTMMSEYMTETGRIKHSRDTGLRPKNQRKIAKAIRRAIGLGLMPSVHRHPLVLKKSFAGRFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.23
4 0.25
5 0.21
6 0.22
7 0.23
8 0.24
9 0.26
10 0.25
11 0.27
12 0.31
13 0.41
14 0.46
15 0.49
16 0.49
17 0.52
18 0.51
19 0.53
20 0.45
21 0.36
22 0.28
23 0.22
24 0.17
25 0.14
26 0.12
27 0.08
28 0.07
29 0.05
30 0.08
31 0.09
32 0.1
33 0.1
34 0.11
35 0.13
36 0.19
37 0.26
38 0.27
39 0.28
40 0.33
41 0.37
42 0.4
43 0.38
44 0.33
45 0.31
46 0.34
47 0.34
48 0.29
49 0.25
50 0.22
51 0.23
52 0.25
53 0.24
54 0.17
55 0.15
56 0.13
57 0.14
58 0.15
59 0.14
60 0.11
61 0.09
62 0.08
63 0.1
64 0.15
65 0.2
66 0.21
67 0.22
68 0.23
69 0.24
70 0.28
71 0.32
72 0.33
73 0.33
74 0.41
75 0.43
76 0.52
77 0.6
78 0.62
79 0.63
80 0.61
81 0.56
82 0.49
83 0.51
84 0.49
85 0.43
86 0.42
87 0.37
88 0.34
89 0.32
90 0.29
91 0.23
92 0.16
93 0.19
94 0.15
95 0.16
96 0.19
97 0.19
98 0.24
99 0.26
100 0.3
101 0.32
102 0.36
103 0.45
104 0.5
105 0.53
106 0.52
107 0.53
108 0.5
109 0.42
110 0.37
111 0.27
112 0.2
113 0.17
114 0.12
115 0.11
116 0.09
117 0.08
118 0.07
119 0.08
120 0.07
121 0.08
122 0.12
123 0.11
124 0.16
125 0.16
126 0.16
127 0.19
128 0.18
129 0.19
130 0.17
131 0.17
132 0.13
133 0.14
134 0.15
135 0.12
136 0.15
137 0.19
138 0.2
139 0.21
140 0.26
141 0.3
142 0.37
143 0.41
144 0.47
145 0.52
146 0.59
147 0.66
148 0.7
149 0.76
150 0.77
151 0.82
152 0.81
153 0.76
154 0.77
155 0.79
156 0.79
157 0.78
158 0.77
159 0.71
160 0.65
161 0.6
162 0.5
163 0.42
164 0.33
165 0.24
166 0.17
167 0.14
168 0.12
169 0.14
170 0.16
171 0.16
172 0.15
173 0.15
174 0.2
175 0.3
176 0.38
177 0.41
178 0.41
179 0.42
180 0.5