Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178AI25

Protein Details
Accession A0A178AI25    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
29-49VPFPWTWTKSRKRRTVFEITLHydrophilic
NLS Segment(s)
PositionSequence
87-93RRVRGKA
Subcellular Location(s) nucl 16.5, cyto_nucl 11.833, cyto 6, cyto_pero 3.833
Family & Domain DBs
Amino Acid Sequences MTPSNAHLLQIPREIRDQILSYLEYDHDVPFPWTWTKSRKRRTVFEITLPNAPRLSVLLTCSRLYEEYMQQSVNKSMVVRWDGGVKRRVRGKALEKHPEYKKAFSRVENITFVIDLGGEEGRIPWLENRKLDHHLLAMCIEFFKSHTSRLSSVIVISRKCAVQDAWHPWQPNVVGTMRPGQTSTGRITDTLGGLQLVRLGRAMCLYSNIDDRYWRRSSASVRNSIYQLQMRYYASDSHTILHPAPEQAQAQFKSYTIETKSKSVGGKRKPLERHEILAIDEVACRMWGWEELRGEDVYKSKEVLRVVPAVDNEPPDVVSRADQEDGEGSDHYFDWDEIMLDARDGNDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.33
3 0.33
4 0.31
5 0.25
6 0.27
7 0.25
8 0.22
9 0.22
10 0.21
11 0.19
12 0.18
13 0.16
14 0.14
15 0.14
16 0.16
17 0.15
18 0.18
19 0.2
20 0.22
21 0.26
22 0.36
23 0.45
24 0.54
25 0.63
26 0.7
27 0.74
28 0.79
29 0.82
30 0.82
31 0.77
32 0.76
33 0.74
34 0.67
35 0.67
36 0.6
37 0.53
38 0.42
39 0.36
40 0.28
41 0.2
42 0.2
43 0.14
44 0.16
45 0.19
46 0.22
47 0.22
48 0.23
49 0.23
50 0.21
51 0.22
52 0.24
53 0.23
54 0.25
55 0.27
56 0.27
57 0.27
58 0.29
59 0.28
60 0.24
61 0.2
62 0.15
63 0.15
64 0.2
65 0.21
66 0.19
67 0.18
68 0.25
69 0.27
70 0.33
71 0.39
72 0.35
73 0.38
74 0.45
75 0.47
76 0.43
77 0.49
78 0.53
79 0.55
80 0.62
81 0.67
82 0.64
83 0.69
84 0.7
85 0.71
86 0.65
87 0.62
88 0.59
89 0.57
90 0.57
91 0.52
92 0.53
93 0.49
94 0.5
95 0.45
96 0.39
97 0.31
98 0.26
99 0.23
100 0.17
101 0.11
102 0.06
103 0.06
104 0.05
105 0.04
106 0.04
107 0.05
108 0.05
109 0.05
110 0.06
111 0.09
112 0.17
113 0.2
114 0.23
115 0.26
116 0.29
117 0.33
118 0.34
119 0.31
120 0.26
121 0.23
122 0.21
123 0.18
124 0.15
125 0.11
126 0.1
127 0.09
128 0.06
129 0.06
130 0.1
131 0.1
132 0.12
133 0.15
134 0.17
135 0.19
136 0.21
137 0.22
138 0.18
139 0.18
140 0.21
141 0.22
142 0.19
143 0.19
144 0.17
145 0.16
146 0.16
147 0.16
148 0.11
149 0.12
150 0.18
151 0.24
152 0.28
153 0.31
154 0.31
155 0.3
156 0.31
157 0.28
158 0.22
159 0.18
160 0.13
161 0.11
162 0.11
163 0.17
164 0.15
165 0.15
166 0.15
167 0.14
168 0.14
169 0.16
170 0.17
171 0.14
172 0.14
173 0.14
174 0.15
175 0.14
176 0.13
177 0.11
178 0.09
179 0.07
180 0.06
181 0.06
182 0.08
183 0.07
184 0.06
185 0.07
186 0.07
187 0.07
188 0.08
189 0.08
190 0.06
191 0.08
192 0.09
193 0.1
194 0.13
195 0.14
196 0.14
197 0.17
198 0.19
199 0.23
200 0.24
201 0.24
202 0.22
203 0.26
204 0.32
205 0.38
206 0.43
207 0.44
208 0.44
209 0.45
210 0.45
211 0.42
212 0.4
213 0.33
214 0.27
215 0.21
216 0.23
217 0.21
218 0.21
219 0.21
220 0.2
221 0.18
222 0.21
223 0.2
224 0.18
225 0.19
226 0.19
227 0.18
228 0.17
229 0.17
230 0.14
231 0.15
232 0.17
233 0.17
234 0.17
235 0.23
236 0.22
237 0.23
238 0.22
239 0.21
240 0.2
241 0.2
242 0.23
243 0.21
244 0.27
245 0.26
246 0.29
247 0.31
248 0.32
249 0.36
250 0.39
251 0.44
252 0.45
253 0.53
254 0.55
255 0.62
256 0.66
257 0.67
258 0.68
259 0.63
260 0.59
261 0.53
262 0.49
263 0.42
264 0.37
265 0.32
266 0.22
267 0.19
268 0.15
269 0.11
270 0.1
271 0.08
272 0.06
273 0.07
274 0.1
275 0.12
276 0.17
277 0.19
278 0.2
279 0.23
280 0.23
281 0.23
282 0.21
283 0.23
284 0.22
285 0.21
286 0.21
287 0.21
288 0.25
289 0.26
290 0.27
291 0.27
292 0.27
293 0.27
294 0.29
295 0.28
296 0.27
297 0.28
298 0.25
299 0.22
300 0.19
301 0.19
302 0.17
303 0.17
304 0.15
305 0.15
306 0.17
307 0.19
308 0.2
309 0.19
310 0.18
311 0.19
312 0.19
313 0.19
314 0.16
315 0.13
316 0.14
317 0.14
318 0.14
319 0.13
320 0.11
321 0.11
322 0.11
323 0.11
324 0.1
325 0.13
326 0.11
327 0.11
328 0.11