Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178AZL8

Protein Details
Accession A0A178AZL8    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
17-71AEPKPEPTKARSRSRSPRRSRSPPRKPKNFSGLKWKNDKRDTRDRDDRRRDDRGGBasic
132-154GGDRDRERKPREPREKKPSAPPIBasic
NLS Segment(s)
PositionSequence
19-150PKPEPTKARSRSRSPRRSRSPPRKPKNFSGLKWKNDKRDTRDRDDRRRDDRGGYDRRERRDFDRDDRRRDDRDDRRRDDRFSDRRGEDRRRDDRRDDRRRDDRHPDRRGDRRDGGDRDRERKPREPREKKPS
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039732  Hub1/Ubl5  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0036211  P:protein modification process  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
Amino Acid Sequences MPSPSPPRDTESKPADAEPKPEPTKARSRSRSPRRSRSPPRKPKNFSGLKWKNDKRDTRDRDDRRRDDRGGYDRRERRDFDRDDRRRDDRDDRRRDDRFSDRRGEDRRRDDRRDDRRRDDRHPDRRGDRRDGGDRDRERKPREPREKKPSAPPIAATGEAMIIVTVNDRLGTKTQVPCLPSDPVKVLKAMVAAKIGRPVHEIMLKRQGERPFHDQLSLADYSISNGVQIDLELNTGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.52
3 0.48
4 0.47
5 0.41
6 0.45
7 0.42
8 0.44
9 0.44
10 0.43
11 0.51
12 0.56
13 0.62
14 0.61
15 0.68
16 0.76
17 0.83
18 0.88
19 0.87
20 0.9
21 0.89
22 0.92
23 0.93
24 0.93
25 0.93
26 0.94
27 0.94
28 0.94
29 0.91
30 0.89
31 0.89
32 0.87
33 0.79
34 0.79
35 0.77
36 0.74
37 0.77
38 0.75
39 0.74
40 0.73
41 0.78
42 0.75
43 0.77
44 0.77
45 0.76
46 0.8
47 0.8
48 0.82
49 0.85
50 0.85
51 0.81
52 0.8
53 0.73
54 0.68
55 0.66
56 0.64
57 0.62
58 0.59
59 0.62
60 0.6
61 0.64
62 0.64
63 0.59
64 0.55
65 0.56
66 0.56
67 0.56
68 0.61
69 0.62
70 0.65
71 0.69
72 0.68
73 0.62
74 0.63
75 0.63
76 0.63
77 0.66
78 0.68
79 0.68
80 0.71
81 0.7
82 0.67
83 0.63
84 0.63
85 0.59
86 0.55
87 0.56
88 0.5
89 0.53
90 0.58
91 0.6
92 0.57
93 0.6
94 0.64
95 0.64
96 0.67
97 0.68
98 0.71
99 0.74
100 0.77
101 0.75
102 0.74
103 0.76
104 0.77
105 0.75
106 0.76
107 0.75
108 0.74
109 0.73
110 0.71
111 0.69
112 0.72
113 0.71
114 0.67
115 0.61
116 0.56
117 0.57
118 0.56
119 0.52
120 0.53
121 0.51
122 0.5
123 0.53
124 0.55
125 0.53
126 0.58
127 0.63
128 0.65
129 0.72
130 0.77
131 0.8
132 0.83
133 0.85
134 0.8
135 0.8
136 0.79
137 0.73
138 0.64
139 0.55
140 0.49
141 0.42
142 0.38
143 0.28
144 0.19
145 0.13
146 0.11
147 0.1
148 0.05
149 0.03
150 0.03
151 0.04
152 0.04
153 0.04
154 0.04
155 0.05
156 0.07
157 0.09
158 0.12
159 0.17
160 0.2
161 0.24
162 0.27
163 0.28
164 0.28
165 0.29
166 0.31
167 0.27
168 0.27
169 0.26
170 0.27
171 0.27
172 0.26
173 0.23
174 0.2
175 0.22
176 0.2
177 0.18
178 0.18
179 0.18
180 0.18
181 0.25
182 0.25
183 0.22
184 0.23
185 0.23
186 0.24
187 0.29
188 0.3
189 0.28
190 0.38
191 0.38
192 0.38
193 0.42
194 0.45
195 0.45
196 0.49
197 0.5
198 0.48
199 0.47
200 0.47
201 0.42
202 0.36
203 0.35
204 0.3
205 0.24
206 0.17
207 0.16
208 0.16
209 0.16
210 0.15
211 0.1
212 0.09
213 0.09
214 0.09
215 0.09
216 0.09
217 0.07