Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178ABG4

Protein Details
Accession A0A178ABG4    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
210-233GGYVRKVKEAKRIEKRKPEIKEIVBasic
NLS Segment(s)
PositionSequence
215-228KVKEAKRIEKRKPE
261-268RFRKGKHR
Subcellular Location(s) cyto_nucl 11, nucl 10, cyto 10, plas 3, mito 1, extr 1, pero 1, E.R. 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR021013  ATPase_Vma12  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0070072  P:vacuolar proton-transporting V-type ATPase complex assembly  
Pfam View protein in Pfam  
PF11712  Vma12  
Amino Acid Sequences MTPGIVRALEHAERHSPDAHAKLQRANEPALADAKPGNAIAHAQLIDLSKLLKQHSPDLQRDHNDIDDPPTTLAALLQNTTIYTPPPPPPPAKSAEYKALMARLRAEEEARSYERMLHPPPTRETFSQRFPSAPAAFSLGATAAPASEEDELTYEEVHRQIILIINILISIVCVAVFIWVAARHWTVGKRLGLSMAGSFGIAVAEVAVYGGYVRKVKEAKRIEKRKPEIKEIVRSWVIDKGQETEHSVPVGGKEKDGDGVRFRKGKHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.29
4 0.31
5 0.34
6 0.38
7 0.39
8 0.4
9 0.43
10 0.46
11 0.5
12 0.47
13 0.45
14 0.4
15 0.34
16 0.33
17 0.31
18 0.25
19 0.21
20 0.18
21 0.16
22 0.15
23 0.14
24 0.12
25 0.1
26 0.11
27 0.1
28 0.13
29 0.12
30 0.11
31 0.12
32 0.13
33 0.13
34 0.12
35 0.12
36 0.1
37 0.12
38 0.15
39 0.16
40 0.17
41 0.24
42 0.32
43 0.38
44 0.42
45 0.46
46 0.51
47 0.52
48 0.53
49 0.48
50 0.42
51 0.36
52 0.31
53 0.28
54 0.23
55 0.2
56 0.17
57 0.15
58 0.13
59 0.11
60 0.11
61 0.1
62 0.09
63 0.08
64 0.08
65 0.08
66 0.08
67 0.09
68 0.09
69 0.07
70 0.09
71 0.12
72 0.15
73 0.2
74 0.24
75 0.27
76 0.3
77 0.33
78 0.36
79 0.36
80 0.37
81 0.35
82 0.38
83 0.37
84 0.34
85 0.31
86 0.31
87 0.29
88 0.25
89 0.24
90 0.18
91 0.18
92 0.18
93 0.18
94 0.13
95 0.14
96 0.18
97 0.17
98 0.17
99 0.15
100 0.18
101 0.2
102 0.23
103 0.23
104 0.27
105 0.28
106 0.31
107 0.34
108 0.34
109 0.35
110 0.33
111 0.38
112 0.34
113 0.37
114 0.38
115 0.35
116 0.32
117 0.3
118 0.34
119 0.27
120 0.24
121 0.18
122 0.16
123 0.16
124 0.15
125 0.14
126 0.08
127 0.07
128 0.06
129 0.06
130 0.03
131 0.03
132 0.03
133 0.04
134 0.04
135 0.04
136 0.05
137 0.06
138 0.06
139 0.06
140 0.07
141 0.06
142 0.07
143 0.07
144 0.07
145 0.06
146 0.06
147 0.06
148 0.08
149 0.08
150 0.08
151 0.07
152 0.07
153 0.07
154 0.07
155 0.06
156 0.03
157 0.03
158 0.02
159 0.02
160 0.02
161 0.03
162 0.03
163 0.03
164 0.03
165 0.04
166 0.05
167 0.06
168 0.07
169 0.08
170 0.08
171 0.11
172 0.13
173 0.14
174 0.2
175 0.21
176 0.21
177 0.21
178 0.21
179 0.2
180 0.19
181 0.16
182 0.11
183 0.09
184 0.08
185 0.07
186 0.06
187 0.05
188 0.04
189 0.04
190 0.03
191 0.02
192 0.02
193 0.03
194 0.02
195 0.02
196 0.03
197 0.04
198 0.06
199 0.08
200 0.09
201 0.15
202 0.2
203 0.24
204 0.34
205 0.43
206 0.52
207 0.61
208 0.71
209 0.75
210 0.81
211 0.87
212 0.86
213 0.82
214 0.81
215 0.8
216 0.77
217 0.77
218 0.69
219 0.68
220 0.61
221 0.56
222 0.48
223 0.45
224 0.38
225 0.31
226 0.3
227 0.25
228 0.26
229 0.27
230 0.31
231 0.28
232 0.29
233 0.26
234 0.26
235 0.23
236 0.24
237 0.3
238 0.24
239 0.22
240 0.22
241 0.22
242 0.28
243 0.3
244 0.3
245 0.3
246 0.35
247 0.41
248 0.44