Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178AIY0

Protein Details
Accession A0A178AIY0    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPISKKDRVQREHKKAEKAGBasic
NLS Segment(s)
PositionSequence
8-26RVQREHKKAEKAGTRAPVK
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 3, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR026939  ZNF706/At2g23090_sf  
Amino Acid Sequences MPISKKDRVQREHKKAEKAGTRAPVKANGLPVKAPKPTSICQNCRREIVNTNKQQLADHALTHPQPTWTKEKCWPSDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.78
3 0.79
4 0.75
5 0.69
6 0.65
7 0.62
8 0.58
9 0.52
10 0.5
11 0.45
12 0.41
13 0.37
14 0.38
15 0.32
16 0.3
17 0.29
18 0.3
19 0.28
20 0.28
21 0.27
22 0.23
23 0.25
24 0.25
25 0.33
26 0.38
27 0.42
28 0.49
29 0.55
30 0.54
31 0.52
32 0.52
33 0.45
34 0.45
35 0.48
36 0.49
37 0.48
38 0.51
39 0.5
40 0.48
41 0.46
42 0.39
43 0.36
44 0.27
45 0.22
46 0.2
47 0.22
48 0.22
49 0.23
50 0.22
51 0.2
52 0.23
53 0.26
54 0.34
55 0.34
56 0.39
57 0.46
58 0.55