Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178BCT4

Protein Details
Accession A0A178BCT4   
Localization Confidence Low
Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
22-44QTDNSVSKKPQPKQQLSKAMEHMHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12, cyto_nucl 10, pero 7, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013217  Methyltransf_12  
IPR026113  METTL2/6/8-like  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0052735  F:tRNA (cytosine-3-)-methyltransferase activity  
Pfam View protein in Pfam  
PF08242  Methyltransf_12  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MSTNTEAPLAPSPEQNDAEKYQTDNSVSKKPQPKQQLSKAMEHMRFAVTVDPIPHASTLTPPTDSLDPTTTNPNEPAENDAYGVPASIAPIRNPASRSHDPSNNQKRTDPFSFGSRYLEEGDNIFEFNAWDHVTVDSTYKAFSEEQYDRQRADPVSEFDRNRFNAQPEKWWNTFYKNNKTNFFKNRKWLAQEFPILGEVGKEDAGPAVLLEVGAGAGNSAFPILQNSRNKGLKIHACDFSKKAVELIRGHELYNPDLIQADVWDVAATPDSENGGLPPGLKENSVDVVLMIFIFSALNPRQWDQAVRNIWRVLKPGGQVLFRDYGRGDLAQVRFKKGRYMEENFYVRGDGTRVYFFEQDELEEIWGGKKREIKQESGDGADELVEKTQALELEGESERGPGPAFEVAHIGVDRRMLVNRQRRLKMYRCWMQAVFRKPGQESQVATSTLRQEKQGEEEDEVAEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.34
4 0.33
5 0.35
6 0.33
7 0.33
8 0.3
9 0.32
10 0.33
11 0.33
12 0.35
13 0.41
14 0.43
15 0.5
16 0.56
17 0.59
18 0.64
19 0.7
20 0.76
21 0.76
22 0.83
23 0.84
24 0.79
25 0.8
26 0.8
27 0.78
28 0.7
29 0.61
30 0.53
31 0.43
32 0.39
33 0.32
34 0.26
35 0.19
36 0.19
37 0.18
38 0.18
39 0.18
40 0.19
41 0.18
42 0.16
43 0.14
44 0.16
45 0.19
46 0.19
47 0.19
48 0.19
49 0.22
50 0.23
51 0.24
52 0.23
53 0.22
54 0.22
55 0.23
56 0.31
57 0.29
58 0.3
59 0.3
60 0.29
61 0.27
62 0.26
63 0.3
64 0.24
65 0.23
66 0.21
67 0.19
68 0.18
69 0.16
70 0.15
71 0.1
72 0.07
73 0.08
74 0.1
75 0.12
76 0.11
77 0.18
78 0.21
79 0.24
80 0.25
81 0.28
82 0.34
83 0.39
84 0.46
85 0.47
86 0.51
87 0.53
88 0.62
89 0.69
90 0.67
91 0.63
92 0.6
93 0.58
94 0.58
95 0.58
96 0.52
97 0.43
98 0.42
99 0.43
100 0.4
101 0.39
102 0.32
103 0.3
104 0.27
105 0.26
106 0.21
107 0.18
108 0.18
109 0.15
110 0.15
111 0.12
112 0.09
113 0.08
114 0.08
115 0.09
116 0.08
117 0.08
118 0.08
119 0.09
120 0.1
121 0.1
122 0.11
123 0.1
124 0.1
125 0.1
126 0.09
127 0.11
128 0.1
129 0.1
130 0.16
131 0.18
132 0.26
133 0.33
134 0.35
135 0.34
136 0.35
137 0.39
138 0.32
139 0.33
140 0.29
141 0.24
142 0.28
143 0.34
144 0.33
145 0.31
146 0.37
147 0.35
148 0.35
149 0.35
150 0.33
151 0.35
152 0.35
153 0.42
154 0.43
155 0.48
156 0.45
157 0.45
158 0.43
159 0.4
160 0.47
161 0.46
162 0.5
163 0.51
164 0.55
165 0.59
166 0.62
167 0.65
168 0.68
169 0.68
170 0.63
171 0.65
172 0.67
173 0.65
174 0.65
175 0.6
176 0.54
177 0.5
178 0.48
179 0.39
180 0.32
181 0.28
182 0.22
183 0.18
184 0.14
185 0.08
186 0.06
187 0.06
188 0.05
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.03
195 0.03
196 0.03
197 0.03
198 0.02
199 0.02
200 0.02
201 0.02
202 0.02
203 0.02
204 0.02
205 0.02
206 0.02
207 0.02
208 0.02
209 0.05
210 0.07
211 0.14
212 0.17
213 0.2
214 0.26
215 0.29
216 0.29
217 0.28
218 0.32
219 0.31
220 0.33
221 0.34
222 0.34
223 0.33
224 0.35
225 0.35
226 0.32
227 0.28
228 0.22
229 0.2
230 0.18
231 0.21
232 0.2
233 0.22
234 0.25
235 0.24
236 0.25
237 0.25
238 0.23
239 0.2
240 0.2
241 0.16
242 0.11
243 0.1
244 0.1
245 0.07
246 0.06
247 0.06
248 0.04
249 0.04
250 0.04
251 0.04
252 0.04
253 0.05
254 0.05
255 0.04
256 0.05
257 0.05
258 0.06
259 0.05
260 0.06
261 0.06
262 0.06
263 0.06
264 0.06
265 0.08
266 0.09
267 0.09
268 0.09
269 0.09
270 0.1
271 0.1
272 0.1
273 0.07
274 0.07
275 0.07
276 0.06
277 0.05
278 0.03
279 0.03
280 0.03
281 0.03
282 0.07
283 0.08
284 0.11
285 0.13
286 0.14
287 0.16
288 0.17
289 0.21
290 0.19
291 0.26
292 0.3
293 0.32
294 0.35
295 0.35
296 0.37
297 0.35
298 0.36
299 0.3
300 0.27
301 0.25
302 0.27
303 0.27
304 0.26
305 0.25
306 0.25
307 0.27
308 0.23
309 0.23
310 0.18
311 0.17
312 0.17
313 0.17
314 0.15
315 0.16
316 0.19
317 0.25
318 0.27
319 0.31
320 0.32
321 0.33
322 0.38
323 0.36
324 0.42
325 0.42
326 0.47
327 0.47
328 0.52
329 0.54
330 0.48
331 0.44
332 0.36
333 0.28
334 0.23
335 0.19
336 0.12
337 0.12
338 0.13
339 0.13
340 0.16
341 0.17
342 0.17
343 0.18
344 0.17
345 0.15
346 0.16
347 0.15
348 0.13
349 0.12
350 0.12
351 0.12
352 0.17
353 0.17
354 0.18
355 0.24
356 0.29
357 0.39
358 0.43
359 0.45
360 0.46
361 0.53
362 0.52
363 0.48
364 0.43
365 0.33
366 0.29
367 0.25
368 0.2
369 0.12
370 0.1
371 0.08
372 0.07
373 0.07
374 0.09
375 0.09
376 0.09
377 0.09
378 0.09
379 0.13
380 0.13
381 0.14
382 0.12
383 0.13
384 0.12
385 0.12
386 0.12
387 0.08
388 0.1
389 0.13
390 0.13
391 0.13
392 0.14
393 0.14
394 0.16
395 0.16
396 0.15
397 0.12
398 0.13
399 0.13
400 0.13
401 0.16
402 0.2
403 0.29
404 0.38
405 0.46
406 0.54
407 0.59
408 0.64
409 0.7
410 0.72
411 0.72
412 0.73
413 0.74
414 0.69
415 0.7
416 0.66
417 0.67
418 0.66
419 0.64
420 0.61
421 0.55
422 0.55
423 0.51
424 0.54
425 0.51
426 0.48
427 0.44
428 0.41
429 0.44
430 0.41
431 0.39
432 0.37
433 0.4
434 0.41
435 0.4
436 0.38
437 0.36
438 0.37
439 0.43
440 0.47
441 0.42
442 0.38
443 0.38
444 0.35