Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178AR81

Protein Details
Accession A0A178AR81   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
251-284LEGKKTQEKKGENKGEPRKRKEDRKKEEAEKGGGBasic
NLS Segment(s)
PositionSequence
254-284KKTQEKKGENKGEPRKRKEDRKKEEAEKGGG
Subcellular Location(s) mito 25.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036788  T_IF-3_C_sf  
IPR036787  T_IF-3_N_sf  
IPR001288  Translation_initiation_fac_3  
Gene Ontology GO:0003743  F:translation initiation factor activity  
Amino Acid Sequences MPPTHLTSTSRALYRIFIAPTLGLRSQQTPNATVPLLFTPAFAPHTRTSPPGPISMRTLTYKKDTSRHAITDHYTIDRAIPGPYINLVDEEGTYHPSVPLSDALAQINRTTQYLVQMSESKVDEFGNLDPNDVPVVKVVSKIALREQHQRKLELARRQAKGLGAGPAPKNLELNWAIAPGDLKHRLGRLKEFLDEGRKVEIMLGPKKKGRAATEDEVRGVMISIEEVVQEVKGSREVKRQGNVGGVLMVTLEGKKTQEKKGENKGEPRKRKEDRKKEEAEKGGGQKAEASL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.26
4 0.22
5 0.21
6 0.2
7 0.21
8 0.24
9 0.21
10 0.19
11 0.2
12 0.24
13 0.26
14 0.3
15 0.31
16 0.29
17 0.3
18 0.31
19 0.29
20 0.25
21 0.23
22 0.2
23 0.21
24 0.18
25 0.16
26 0.14
27 0.16
28 0.19
29 0.18
30 0.21
31 0.2
32 0.24
33 0.25
34 0.28
35 0.29
36 0.33
37 0.34
38 0.36
39 0.36
40 0.35
41 0.38
42 0.37
43 0.37
44 0.34
45 0.35
46 0.31
47 0.35
48 0.38
49 0.38
50 0.41
51 0.43
52 0.46
53 0.49
54 0.49
55 0.45
56 0.43
57 0.41
58 0.39
59 0.36
60 0.3
61 0.25
62 0.22
63 0.2
64 0.18
65 0.16
66 0.12
67 0.11
68 0.09
69 0.09
70 0.1
71 0.1
72 0.09
73 0.09
74 0.09
75 0.08
76 0.08
77 0.09
78 0.09
79 0.1
80 0.1
81 0.1
82 0.09
83 0.09
84 0.09
85 0.09
86 0.09
87 0.09
88 0.1
89 0.11
90 0.12
91 0.13
92 0.13
93 0.12
94 0.13
95 0.12
96 0.1
97 0.1
98 0.1
99 0.13
100 0.14
101 0.14
102 0.14
103 0.16
104 0.16
105 0.19
106 0.19
107 0.15
108 0.14
109 0.13
110 0.12
111 0.1
112 0.11
113 0.15
114 0.14
115 0.15
116 0.14
117 0.14
118 0.15
119 0.13
120 0.12
121 0.06
122 0.07
123 0.07
124 0.07
125 0.07
126 0.09
127 0.09
128 0.1
129 0.13
130 0.17
131 0.19
132 0.28
133 0.34
134 0.38
135 0.4
136 0.41
137 0.39
138 0.42
139 0.47
140 0.44
141 0.48
142 0.49
143 0.48
144 0.48
145 0.48
146 0.39
147 0.35
148 0.29
149 0.23
150 0.16
151 0.19
152 0.18
153 0.19
154 0.19
155 0.17
156 0.16
157 0.13
158 0.17
159 0.14
160 0.15
161 0.13
162 0.12
163 0.12
164 0.12
165 0.12
166 0.09
167 0.13
168 0.13
169 0.14
170 0.15
171 0.18
172 0.22
173 0.24
174 0.28
175 0.29
176 0.29
177 0.29
178 0.3
179 0.29
180 0.32
181 0.3
182 0.27
183 0.23
184 0.21
185 0.2
186 0.19
187 0.18
188 0.18
189 0.25
190 0.29
191 0.3
192 0.32
193 0.35
194 0.37
195 0.39
196 0.37
197 0.36
198 0.39
199 0.43
200 0.48
201 0.47
202 0.44
203 0.39
204 0.36
205 0.28
206 0.2
207 0.13
208 0.06
209 0.05
210 0.04
211 0.04
212 0.04
213 0.05
214 0.05
215 0.05
216 0.05
217 0.05
218 0.06
219 0.12
220 0.14
221 0.17
222 0.26
223 0.33
224 0.39
225 0.42
226 0.45
227 0.41
228 0.44
229 0.41
230 0.33
231 0.27
232 0.2
233 0.16
234 0.13
235 0.1
236 0.06
237 0.06
238 0.06
239 0.07
240 0.09
241 0.17
242 0.22
243 0.29
244 0.38
245 0.46
246 0.54
247 0.64
248 0.73
249 0.73
250 0.78
251 0.82
252 0.84
253 0.86
254 0.86
255 0.86
256 0.85
257 0.89
258 0.9
259 0.91
260 0.9
261 0.9
262 0.91
263 0.89
264 0.89
265 0.85
266 0.8
267 0.76
268 0.72
269 0.67
270 0.58
271 0.49