Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178AU53

Protein Details
Accession A0A178AU53    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
35-54TCPNRMKRRRSSAGKICEKCHydrophilic
NLS Segment(s)
PositionSequence
98-115ARRMTRRARGNGNGEGKK
Subcellular Location(s) mito 13, nucl 11, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MCFILLSTCNTCTSTIHKRYALCTHAASHSFDPATCPNRMKRRRSSAGKICEKCEPRRGSLSEMPSAEGSATREGQEEKREEEERYAEVLKVLGMSRARRMTRRARGNGNGEGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.36
3 0.41
4 0.43
5 0.44
6 0.48
7 0.53
8 0.48
9 0.41
10 0.36
11 0.32
12 0.33
13 0.33
14 0.32
15 0.26
16 0.26
17 0.23
18 0.21
19 0.22
20 0.23
21 0.25
22 0.24
23 0.26
24 0.31
25 0.41
26 0.5
27 0.54
28 0.58
29 0.65
30 0.72
31 0.77
32 0.79
33 0.77
34 0.79
35 0.81
36 0.73
37 0.66
38 0.63
39 0.6
40 0.54
41 0.53
42 0.46
43 0.39
44 0.42
45 0.42
46 0.4
47 0.4
48 0.4
49 0.34
50 0.32
51 0.3
52 0.24
53 0.23
54 0.17
55 0.12
56 0.11
57 0.09
58 0.1
59 0.09
60 0.1
61 0.12
62 0.15
63 0.2
64 0.2
65 0.21
66 0.26
67 0.27
68 0.27
69 0.28
70 0.28
71 0.24
72 0.25
73 0.23
74 0.18
75 0.16
76 0.15
77 0.12
78 0.12
79 0.11
80 0.12
81 0.14
82 0.16
83 0.23
84 0.3
85 0.34
86 0.37
87 0.45
88 0.51
89 0.58
90 0.66
91 0.68
92 0.69
93 0.74
94 0.75
95 0.77