Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165XLS3

Protein Details
Accession A0A165XLS3    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
49-74HYKTAYDRPRPGRPRKWNQENMKPIVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036388  WH-like_DNA-bd_sf  
Amino Acid Sequences MTRTHQLLSPTRRGRILGMRLAGKSLRQIVHKTHVPLATVHYTVQRDVHYKTAYDRPRPGRPRKWNQENMKPIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.47
3 0.46
4 0.4
5 0.39
6 0.38
7 0.37
8 0.37
9 0.33
10 0.25
11 0.22
12 0.22
13 0.2
14 0.2
15 0.23
16 0.25
17 0.31
18 0.33
19 0.33
20 0.32
21 0.31
22 0.29
23 0.26
24 0.26
25 0.21
26 0.19
27 0.17
28 0.16
29 0.16
30 0.15
31 0.17
32 0.16
33 0.16
34 0.17
35 0.23
36 0.2
37 0.2
38 0.24
39 0.31
40 0.36
41 0.4
42 0.47
43 0.48
44 0.58
45 0.67
46 0.74
47 0.76
48 0.8
49 0.85
50 0.87
51 0.91
52 0.91
53 0.91
54 0.91