Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166AY67

Protein Details
Accession A0A166AY67    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
304-326LDRLLAERRQDRRRSRYEYVARFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14.5, cyto_nucl 9, extr 3, pero 3, nucl 2.5, mito 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002034  AIPM/Hcit_synth_CS  
IPR013785  Aldolase_TIM  
IPR000891  PYR_CT  
Gene Ontology GO:0046912  F:acyltransferase activity, acyl groups converted into alkyl on transfer  
GO:0019752  P:carboxylic acid metabolic process  
GO:0044249  P:cellular biosynthetic process  
GO:1901566  P:organonitrogen compound biosynthetic process  
GO:0044283  P:small molecule biosynthetic process  
Pfam View protein in Pfam  
PF00682  HMGL-like  
PROSITE View protein in PROSITE  
PS00816  AIPM_HOMOCIT_SYNTH_2  
PS50991  PYR_CT  
Amino Acid Sequences MVSSSLVVLADGLLPFDAFGFEYLELTSSAASEQSFLDCEAICKLGLMPKILTHIRCHMDDARIAVETGVDGVDVVIGISSLLRHPNPRQVDDLVRTLRSVVSCDIEIHLHNDTGMAIANAYSARMAGATHIDTSVLGIGERVGITTLGSLVACMYTANPEYVKSKYNLPMLREVENLVAEAVEVNVPFSNPITGYCAFTHKAGIHAKAILNNPSTYEILKPEDFGLTRYVSIGHRLTGWNAVKSRVEQLGLKLTDDEIKDATAKIKELADVRTQSMDDVDSLLRVYHSGIQSGELAVGQKVTLDRLLAERRQDRRRSRYEYVARFLEFLVCVLAAFSQSFVYQIKTAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.07
5 0.05
6 0.06
7 0.08
8 0.08
9 0.09
10 0.09
11 0.1
12 0.1
13 0.1
14 0.09
15 0.07
16 0.07
17 0.07
18 0.07
19 0.07
20 0.08
21 0.09
22 0.1
23 0.1
24 0.11
25 0.1
26 0.12
27 0.12
28 0.13
29 0.11
30 0.1
31 0.11
32 0.14
33 0.17
34 0.18
35 0.17
36 0.18
37 0.24
38 0.28
39 0.28
40 0.27
41 0.32
42 0.34
43 0.34
44 0.37
45 0.36
46 0.34
47 0.34
48 0.33
49 0.27
50 0.24
51 0.23
52 0.18
53 0.13
54 0.1
55 0.09
56 0.06
57 0.04
58 0.04
59 0.03
60 0.03
61 0.03
62 0.03
63 0.02
64 0.02
65 0.03
66 0.03
67 0.03
68 0.05
69 0.09
70 0.1
71 0.15
72 0.19
73 0.27
74 0.32
75 0.35
76 0.37
77 0.37
78 0.42
79 0.4
80 0.44
81 0.38
82 0.33
83 0.31
84 0.28
85 0.26
86 0.2
87 0.19
88 0.14
89 0.13
90 0.14
91 0.14
92 0.14
93 0.14
94 0.14
95 0.14
96 0.13
97 0.11
98 0.1
99 0.1
100 0.09
101 0.08
102 0.07
103 0.05
104 0.04
105 0.04
106 0.05
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.06
116 0.07
117 0.07
118 0.07
119 0.07
120 0.07
121 0.07
122 0.07
123 0.05
124 0.04
125 0.04
126 0.04
127 0.05
128 0.05
129 0.04
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.05
144 0.05
145 0.06
146 0.06
147 0.08
148 0.1
149 0.11
150 0.13
151 0.13
152 0.17
153 0.21
154 0.27
155 0.29
156 0.29
157 0.35
158 0.35
159 0.35
160 0.31
161 0.28
162 0.22
163 0.19
164 0.17
165 0.09
166 0.07
167 0.05
168 0.04
169 0.04
170 0.03
171 0.03
172 0.04
173 0.04
174 0.04
175 0.04
176 0.04
177 0.05
178 0.04
179 0.05
180 0.09
181 0.1
182 0.12
183 0.13
184 0.15
185 0.16
186 0.16
187 0.17
188 0.13
189 0.18
190 0.19
191 0.2
192 0.18
193 0.19
194 0.2
195 0.22
196 0.24
197 0.22
198 0.21
199 0.19
200 0.19
201 0.19
202 0.19
203 0.16
204 0.15
205 0.14
206 0.16
207 0.16
208 0.16
209 0.14
210 0.15
211 0.15
212 0.15
213 0.15
214 0.12
215 0.12
216 0.12
217 0.13
218 0.11
219 0.16
220 0.15
221 0.13
222 0.14
223 0.14
224 0.15
225 0.22
226 0.23
227 0.23
228 0.23
229 0.26
230 0.25
231 0.26
232 0.29
233 0.22
234 0.22
235 0.19
236 0.21
237 0.27
238 0.26
239 0.25
240 0.21
241 0.2
242 0.22
243 0.21
244 0.2
245 0.12
246 0.12
247 0.13
248 0.13
249 0.16
250 0.14
251 0.14
252 0.15
253 0.15
254 0.17
255 0.19
256 0.21
257 0.24
258 0.24
259 0.25
260 0.25
261 0.24
262 0.22
263 0.2
264 0.17
265 0.12
266 0.12
267 0.1
268 0.09
269 0.09
270 0.09
271 0.08
272 0.08
273 0.09
274 0.13
275 0.13
276 0.15
277 0.15
278 0.16
279 0.16
280 0.16
281 0.15
282 0.1
283 0.1
284 0.08
285 0.08
286 0.07
287 0.08
288 0.08
289 0.09
290 0.1
291 0.09
292 0.1
293 0.16
294 0.23
295 0.25
296 0.33
297 0.39
298 0.48
299 0.57
300 0.66
301 0.7
302 0.73
303 0.8
304 0.8
305 0.79
306 0.81
307 0.82
308 0.8
309 0.77
310 0.71
311 0.63
312 0.55
313 0.48
314 0.41
315 0.3
316 0.23
317 0.17
318 0.12
319 0.11
320 0.1
321 0.1
322 0.08
323 0.08
324 0.08
325 0.08
326 0.08
327 0.1
328 0.11
329 0.14