Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166BNQ9

Protein Details
Accession A0A166BNQ9    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
144-163ARNPPPPSKIPPSPRKRVLSHydrophilic
NLS Segment(s)
PositionSequence
124-176KNARMAPPSPLKKPAFGGGGARNPPPPSKIPPSPRKRVLSGAPPPPSPNKPKS
Subcellular Location(s) nucl 9cyto 9cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR018851  Borealin_N  
Pfam View protein in Pfam  
PF10444  Nbl1_Borealin_N  
Amino Acid Sequences MGKYTAEEKQQLLDNLGIETAHRIRMLQTRLADEVSAYIARHERQITALPKLVRALTMKEFADNYNGDPQAALVGLQKARMGYDAPPLDRTAMKRKWVQDAEDKGEGPSKIAHGHDINPARSVKNARMAPPSPLKKPAFGGGGARNPPPPSKIPPSPRKRVLSGAPPPPSPNKPKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.2
4 0.16
5 0.11
6 0.15
7 0.14
8 0.14
9 0.13
10 0.13
11 0.17
12 0.24
13 0.28
14 0.29
15 0.29
16 0.31
17 0.32
18 0.32
19 0.29
20 0.21
21 0.18
22 0.15
23 0.13
24 0.1
25 0.11
26 0.13
27 0.13
28 0.17
29 0.17
30 0.16
31 0.17
32 0.24
33 0.26
34 0.27
35 0.31
36 0.28
37 0.28
38 0.29
39 0.27
40 0.21
41 0.2
42 0.2
43 0.18
44 0.21
45 0.2
46 0.2
47 0.21
48 0.19
49 0.21
50 0.17
51 0.16
52 0.18
53 0.18
54 0.16
55 0.15
56 0.15
57 0.11
58 0.11
59 0.09
60 0.05
61 0.07
62 0.07
63 0.08
64 0.08
65 0.08
66 0.08
67 0.08
68 0.08
69 0.07
70 0.13
71 0.15
72 0.15
73 0.16
74 0.16
75 0.17
76 0.17
77 0.2
78 0.22
79 0.24
80 0.28
81 0.31
82 0.33
83 0.4
84 0.41
85 0.41
86 0.41
87 0.43
88 0.43
89 0.4
90 0.38
91 0.3
92 0.32
93 0.28
94 0.21
95 0.16
96 0.12
97 0.13
98 0.13
99 0.16
100 0.14
101 0.16
102 0.22
103 0.26
104 0.26
105 0.26
106 0.27
107 0.24
108 0.26
109 0.28
110 0.24
111 0.29
112 0.31
113 0.31
114 0.37
115 0.38
116 0.4
117 0.47
118 0.49
119 0.43
120 0.49
121 0.47
122 0.43
123 0.44
124 0.42
125 0.35
126 0.31
127 0.32
128 0.3
129 0.35
130 0.35
131 0.34
132 0.33
133 0.33
134 0.34
135 0.33
136 0.31
137 0.32
138 0.38
139 0.47
140 0.54
141 0.62
142 0.7
143 0.75
144 0.8
145 0.78
146 0.74
147 0.71
148 0.69
149 0.68
150 0.68
151 0.67
152 0.63
153 0.59
154 0.6
155 0.6
156 0.61